KEGG   Thielavia terrestris: THITE_125777Help
Entry
THITE_125777      CDS       T02228                                 

Definition
delta-9 acyl-CoA desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
ttt  Thielavia terrestris
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    THITE_125777
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    THITE_125777
Enzymes [BR:ttt01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     THITE_125777
Lipid biosynthesis proteins [BR:ttt01004]
 Desaturase
  First
   THITE_125777
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(join(7744312..7744915,7744988..7745122,7745172..7745574,7745642..7745818,7745885..7745999))
Genome map
AA seq 477 aa AA seqDB search
MASSSSSSSSAVPQAEAFPDGTTDHIPLRKKAYDIRKPHITEQPITWSNWYQHVNWLNTT
FILIIPLVGMIASYWVPLQPKTAIFAVVYYFYSGLGITAGYHRLWAHSSYKASLPLKIFL
AAGGSAAVEGSARWWSSLHRSHHRYTDTDKDPYSVRKGLLYSHIGWMVMKQNPRRIGRTD
ITDLNEDPVVVWQHRHFIKCVVTMALIVPTLVCGFGWGDFLGGYVYAGILRIFFIQQATF
CVNSLAHWLGDQPFDDRNSPRDHVLTALVTLGEGYHNFHHEFPSDFRNAIEWWQYDPTKW
FIWTMKQLGLAWNLKKFPQNEIEKGRVQQLQKKLDQKRATLDWGVPLESLPVISWDDFVE
QSKNGKAWVAIAGVIHDVGKFIADHPGGKALISSAIGKDATAVFNGGVYNHSNAAHNLIS
TMRVGVLRGGCEVEIWKRAQAENKDAVPITDSSGQRIVRAGDQVTRVSRPVASADAA
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtcctcgtcgtcgtcgtcgtcggcggtgccgcaggccgaggctttccccgat
ggcaccactgaccacattcccctgcggaagaaagcctacgatatccgcaagcctcatatc
acggagcagcccataacatggagcaactggtaccagcacgtcaactggctgaacacgacc
ttcatcctcatcatccccctggtcggcatgatcgcgtcgtactgggttcctctgcaaccc
aagactgctatcttcgccgtggtttactatttctactctggtctcggaatcaccgccggc
taccatcgcctctgggctcactcgagctacaaggcttcgctgcccctcaagatcttcctc
gccgccggtggctctgccgccgtcgaaggcagcgcgcgatggtggtccagccttcaccgc
tcgcaccaccgctacaccgataccgataaggatccctattccgtccgcaagggtcttctc
tacagccacatcggctggatggtcatgaagcagaacccgcgccgcatcggccgcaccgac
atcactgatctgaatgaagaccccgtcgttgtctggcagcaccgccacttcatcaagtgt
gtcgtcaccatggccctgatcgtgcccacgcttgtgtgcggtttcggctggggtgacttc
ttgggcggctacgtctacgctggtattctgagaattttcttcatccagcaagccacattc
tgcgtcaacagccttgcccactggctcggtgaccagcccttcgacgaccgcaactcgccg
agagaccacgtcttgaccgccctggtgacccttggcgagggctaccacaacttccaccac
gaattcccgagcgacttccgcaacgccatcgagtggtggcagtacgaccccaccaagtgg
ttcatctggaccatgaagcagctcggcctcgcctggaacctgaagaagttcccccagaac
gagatcgagaagggccgtgtgcagcagctgcagaagaagctcgaccagaagcgggccacc
ctcgactggggcgtaccgctcgagagcctccctgtcatcagctgggacgacttcgtcgaa
cagagcaagaacggcaaggcttgggttgccatcgccggtgttatccacgacgtcggcaag
ttcatcgctgaccaccccggcggcaaggctctgatctcatccgccatcggcaaggatgcc
accgccgtcttcaacggcggtgtctacaaccactccaacgccgcccacaacctcatctcg
accatgagagtgggcgtcctgcggggtggctgcgaggtggagatctggaagcgcgcccaa
gccgagaataaggacgcagtccccatcaccgactcgtccggccagcggatcgtccgtgcc
ggcgaccaggtgacgcgcgtgagccgcccggttgccagcgccgacgccgcatga

DBGET integrated database retrieval system