KEGG   Thielavia terrestris: THITE_127436Help
Entry
THITE_127436      CDS       T02228                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ttt  Thielavia terrestris
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THITE_127436
Enzymes [BR:ttt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     THITE_127436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5:complement(join(1352111..1352497,1352646..1352978,1353071..1353334))
Genome map
AA seq 327 aa AA seqDB search
MVERANKPKPPTLSSTPGLPPQATVTFSDDNSRVIAELPTGESVTVLLYGATVISWKDAQ
GDEKLWLSEAAKLDGSRAVRGGIPVVFPVFGTAPTHPQTKDLPQHGFARTSRWEFLGKST
SESQTGSAANGPAVKLDFGLSSAAPGLDPIAAARWPFKFNLIYSVTLTQTSLTTSIVVTN
DDSAPFDCQVLMHTYLRVKDITAVQVQGLADASYIDKVDGGARKTQSAAEVTITGETDRV
YTPAGDPGAGPVTVVEAGRPVYAVTRDNLSNVVVWNPWADKAQGIADFAPKDGFRNMICI
EPGAVGAWQSLEAGDAFEGAQTITLLG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggtcgagcgcgccaacaagcccaagccgccaacgctgtcctccacccccggcctgccg
ccgcaggcgacagtgaccttctcggacgacaattcacgtgtgattgccgagctgcctacg
ggcgagagcgtcacagtcctgctctacggcgccaccgtcatcagctggaaggatgcgcag
ggcgacgagaagctgtggttgagtgaggcggccaagctggacgggagccgcgcggtgagg
ggagggattcccgttgtgtttccggtcttcggcactgccccgacccacccccaaaccaag
gacctgccgcaacacggcttcgcgcgcacctcgcgttgggagttcctgggcaagtcgacg
tcggagtcacagaccggcagcgcggccaacgggccggccgtcaagctcgacttcggcctc
agctcagcggcgccgggactggacccgatcgccgccgcacgctggccgttcaagttcaac
cttatctacagcgtcacgctgacccagaccagcctgaccaccagcatcgtcgtaaccaac
gacgactcggcgccgttcgactgccaggtgctgatgcatacttacctgcgggtcaaggac
atcaccgccgtgcaagtccaaggcctcgccgacgcgtcgtacatcgacaaggtcgacggc
ggcgcccgcaagacgcagtcggctgcagaggtgaccatcacgggcgagacggaccgcgtg
tacacgccggcgggcgatccgggcgcgggccccgtgacggtggtcgaggcgggccggccg
gtctacgcggtcacgcgcgacaacctgagcaacgtggtcgtgtggaacccgtgggccgac
aaggcgcagggcatcgccgacttcgcgcccaaggacggcttccgcaacatgatctgcatc
gagcccggcgcggtgggcgcgtggcagtcgctggaggcgggcgacgcgtttgagggcgcc
cagacgatcacgcttttgggctga

DBGET integrated database retrieval system