KEGG   Thielavia terrestris: THITE_128217Help
Entry
THITE_128217      CDS       T02228                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ttt  Thielavia terrestris
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    THITE_128217
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    THITE_128217
  Amino acid metabolism
   00310 Lysine degradation
    THITE_128217
Enzymes [BR:ttt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     THITE_128217
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:join(1482395..1482637,1482703..1483062,1483118..1483510,1483578..1483874)
Genome map
AA seq 430 aa AA seqDB search
MLYRGLRFAARAAPRLSLYNTSSALRQLPVQFQHVRTYADKVIKVPAMAESISEGTLKQW
NKAVGDFVEQDEEIATIETDKIDVAVNAPEAGIIKEFFVNEEDTVTVGQDLVRIELGGAP
SGERPAAEEAKEAPKEPTPQTQPEQRTTQEPKPQETKPQETKPASQPTPVVEEAPSPKQP
SKPAKAAPEAPATLGSREERRVKMNRMRLRIAERLKQSQNTAASLTTFNEVDMSALMEFR
NKYKDEVLKKTGVKLGFMSAFSRACVLAMRDLPIVNASIEGPNGGDTIVYRDYVDISVAV
ATEKGLVTPVVRNAESMDMIGIEKAIADMGKKARDGKLTIEDMAGGTFTISNGGVFGSLM
GTPIINLPQTAVLGLHAIKERPVAVNGKVEIRPMMYLALTYDHRLLDGREAVQFLIKVKE
YIEDPRKMLL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgctgtatcgcggactccggtttgcggctcgcgccgctcccagactgtcgctctacaac
accagctcggcgctgcggcagcttcctgtgcaattccagcatgtacgaacctacgccgac
aaggtcatcaaggtgcccgcaatggccgagtcgatcagcgagggaacattgaagcaatgg
aacaaggcagtgggggactttgttgagcaagacgaggagatcgcgacgatcgagaccgac
aagatcgatgttgctgtgaacgcccctgaggcgggcatcatcaaggagttttttgtcaac
gaggaggataccgttaccgtcggccaggacctcgtgcgcattgaactcggtggcgcgcct
tcgggagagaggcctgccgcggaagaggcgaaggaggcacccaaggagccaacacctcaa
acacaacccgagcaaaggacgactcaggagcccaagcctcaggaaaccaagcctcaggaa
accaagccggctagccagcccacgcccgtagtagaggaggctccgtcgccgaagcagccg
agcaagcccgcaaaggctgcccctgaagcccctgccaccctgggcagccgcgaggagagg
agagtcaagatgaaccggatgcgtctccggattgcggagcgcctgaagcagtcgcagaac
acggccgcgtcgctcaccacgttcaacgaggtcgacatgtcggcgctgatggagttccgc
aacaagtacaaggatgaggttctgaagaagaccggcgtgaagctgggcttcatgagcgcc
ttctcccgggcctgcgtgctcgccatgcgcgacctccccatcgttaacgcgtcgatcgag
ggccccaacggcggtgataccatcgtctacagggactacgtcgatatcagcgtcgccgtg
gcgactgagaagggtctcgtcacccctgttgtgcgcaatgctgagtccatggacatgatc
ggcattgaaaaggctattgccgatatgggcaagaaggctcgcgacggaaagctcacgatt
gaggacatggctggcggcactttcactatcagcaacgggggcgtttttggctctctgatg
gggacccctatcatcaaccttccccagacggctgtcctcggcctgcatgctatcaaggag
cgacctgtcgccgttaacggcaaggtggagatccggcccatgatgtaccttgctctcacc
tacgaccaccgtctgctggacggcagggaggctgtgcagttcctgatcaaggtgaaggag
tacatcgaggacccgcgcaagatgctcctctag

DBGET integrated database retrieval system