KEGG   Thielavia terrestris: THITE_135612Help
Entry
THITE_135612      CDS       T02228                                 

Definition
hypothetical protein
Orthology
K11378  
histone acetyltransferase SAS3 [EC:2.3.1.48]
Organism
ttt  Thielavia terrestris
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(join(8130925..8130958,8131450..8133940,8134089..8134767))
Genome map
AA seq 1067 aa AA seqDB search
MADAQLMEEELQQSALQSEREANPAQEGLDGDLETGDGSAFAPQSHINVGAGSMDGDGDE
DMEYDERQRDESELDEEHDDESHSDGSEEDDDDDVFEEDAEGEEDDEQVPRSHRPLRRSA
SMTNGRGDGDDDGDGDDEEGVGAVKIRPGQTDDDDESSVDSASLESSSDAESEDEAEWDA
AENDDADEDEESGNTAGHCMFCKQDEEHDPAEEFEVFLACIKCGDNGPESWRCPKCADES
DSAAAEEVNDEVRMDGITDATASPATRRASAPKLARDLLPSQRGTIKPDSHSVFNQLVLD
EDPMDGSRVLRKRKTSSVVSDEHGVALRKRRRNTSEEHSNEGAATGQDDSSRPVSRSLRI
KIPNSPATIVKSTRNSIIVRFRVNPSALRQILSRNPRGPKKRSSRSRRRTSRSESTRAAP
LPMAAITTPFTPSAYSQPFYSFYDKETDELKGKPYGGILTEAEADTSKTMPANEDRRRFD
EAKQKAEEEWRQRLLKMQAEVEVPVKKSRKASGPASQIECIEFGGWEIDTWYAAPYPEEY
SRNRVLYICEFCLKYMNSDYVAWRHKLKCPAKHPPGDEIYRHGSVSVFEVDGRKNPVYCQ
NLCLLAKLFLGSKTLYYDVEPFLFYVLCEYDDLGYHFVGYFSKEKRASSQNNVSCILTLP
IHQRKGYGNLLIDFSYLLTRVEKKTGSPEKPLSDMGLVSYRNYWRLVMCRYLLEHFSEEK
SGKTGLSIKKISDDTGMTPDDVISALEGLRCLVRDPQTQLYAFRVDLNYCREYVAKWEAK
KYVQLNPKALTWTPYVMGRSNATNFELGPALNAIAPREEEEEVKPVVPSQEPLVNGTGPP
SQEDTPAEEAKVTLEPAVLESTEPGKTAGAGSVANDDSKPNGILTDGDLAEQQKRQEPEP
APAPAPAPEPEPVKPRPEDWMQQYKDIPPTRFEVVPPVNGRRADRSRALIPRPPVVRPAS
STPRPRPRRSAGGRRSAASRPRTGTSSSSKRKPGGTGRGPGRWPKGTKKSDYGNADSGPG
LPPAWIAERARLAALAAARKKEGADVKDTVQVQSPTVFPTVDAEQRV
NT seq 3204 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgctcagctcatggaggaggagctgcagcaaagcgccctgcagtccgagcgg
gaggcgaaccctgcccaagaaggcttggacggggatttggagacgggtgacggcagtgcc
ttcgcaccccagagccacataaatgtcggtgcgggatccatggatggtgatggggatgaa
gatatggaatatgacgagcggcaaagggatgaatccgagcttgacgaggaacacgacgac
gagagccacagcgatggctctgaagaagatgatgatgacgatgtcttcgaggaggatgcc
gagggagaagaagacgatgaacaagtgccccggagccaccgaccgctgcgcagatcggca
agcatgacaaacggccgcggagacggagacgacgacggcgacggcgacgatgaagaaggc
gtcggtgctgtcaaaatacgaccgggacagacggacgatgacgatgagagtagtgtggat
tctgcgagcctggagagtagtagcgatgctgaatccgaggacgaggcagagtgggacgct
gccgagaacgacgatgccgatgaggatgaggaatctggaaacaccgcgggccactgcatg
ttctgtaaacaggacgaggaacacgacccagccgaggagttcgaggtattcctggcatgc
atcaagtgcggggacaacggtcccgaaagctggagatgtccaaagtgcgcagacgaatcg
gactctgctgccgctgaagaagtgaacgatgaagtgaggatggacggaataaccgatgcg
acagcctctcccgcaaccaggcgggcaagcgcacccaagctcgcccgagatttgcttcct
tctcagcgagggaccatcaaacccgactctcactccgtcttcaatcagctggttcttgac
gaggacccgatggatggatcccgtgtgcttagaaagcgcaaaacatcatcggtcgtctca
gatgaacacggtgtggccctccggaagcggcgtaggaatacctccgaggaacatagcaac
gagggtgcagcaaccggacaggacgactcatctcggccggtttccaggtctctacggatc
aagatccctaattcgccggcaaccatcgtcaagagcactcgcaatagcattattgttagg
ttccgtgtgaacccgtccgcgctccggcagatcctatccaggaatcccagagggccgaaa
aaacggtctagcaggtccaggaggcggacgtcaagaagcgagtctacccgtgccgccccc
ttgcccatggcggccattacgacaccattcacacccagcgcctattcgcaacccttctac
tcgttctatgataaggaaaccgacgagttgaaaggcaagccgtacggcgggattctcacc
gaagcggaggcggacacctccaagacgatgccagcaaacgaagaccgccggcgctttgac
gaagccaaacagaaagccgaagaggaatggaggcagcggctactcaagatgcaggctgaa
gtggaggtgcccgtcaagaagtcgaggaaggcatccggccccgccagccaaattgaatgc
atcgagtttggcggctgggagatcgacacctggtatgctgctccttaccccgaggagtat
agccggaatcgcgtcctttatatctgcgagttctgcctcaagtacatgaactcggactac
gtggcttggcgccacaaactgaagtgtccggcgaagcatccccccggggacgagatttac
aggcacggctcggtctcggtctttgaggttgacggccgcaagaatccagtttactgccag
aatctgtgcctcctggcgaagctcttcctcggatccaagactctctattacgacgtggag
ccgttcctcttctatgtgctctgcgaatacgacgatctgggctaccactttgtcggctac
ttttcgaaggagaagcgcgccagcagtcagaacaacgtctcttgtattcttaccctccca
attcaccagcgaaagggatacggcaacctgttgatcgacttctcctatcttctcaccaga
gtggagaagaagacggggtcccccgagaagccactctcggacatgggattggtttcgtat
cggaactactggcggctcgtgatgtgccgctaccttctagagcatttctccgaagagaag
tccggcaagacgggtctcagcatcaaaaagatctcggacgacaccggcatgacgccggac
gacgtgatttcggcattggaagggttgagatgcttggtccgggacccgcaaacacagcta
tacgccttccgggttgaccttaactactgccgagagtatgtggcgaagtgggaggccaag
aagtacgtgcagctcaatccgaaggctttgacgtggacgccgtacgtcatgggtagaagc
aacgcgacgaacttcgagttgggcccggcgttgaacgcgattgccccgcgggaagaggag
gaggaggtgaagccggttgtcccctctcaggaaccactggtcaacgggacagggccgccg
agtcaggaagacactcccgccgaggaagcaaaggtcacgctcgagcctgcggttctggag
tcaacggagccaggcaagacggccggcgcaggtagcgttgccaacgacgacagcaagccc
aacggcatcctcaccgacggcgaccttgcagaacaacagaagcgccaagagcccgagccc
gcgcccgcgcctgcgcccgcgcccgagcccgagcccgtcaagccccggcccgaggactgg
atgcagcagtacaaagacatcccacccacgcgcttcgaggtggtgccgccggtcaacggg
cgccgcgcggaccgctcgcgcgcccttatcccgcggccgccggtcgtccggcccgccagc
agcaccccgcgaccgcggccccggcggtccgccggcggccgccgctccgccgcttcccgg
ccgaggaccggcacgagcagcagcagcaagcgcaagccgggagggacgggccgcgggccg
gggcgctggcccaagggcaccaagaagagcgactacggcaacgccgacagcgggccgggg
ctcccgccggcctggatcgcggagcgcgcgaggctggcggcgctggcggcggcgcggaag
aaggagggcgcggacgtcaaagatacggtgcaggtgcagtccccgacggtttttccgaca
gtggacgccgagcagagggtttag

DBGET integrated database retrieval system