KEGG   Thielavia terrestris: THITE_136564Help
Entry
THITE_136564      CDS       T02228                                 

Definition
histone H2B-like protein
Orthology
K11252  
histone H2B
Organism
ttt  Thielavia terrestris
Brite
Exosome [BR:ttt04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   THITE_136564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(join(1477181..1477359,1477413..1477484,1477596..1477758))
Genome map
AA seq 137 aa AA seqDB search
MPPKAADKKPATKAPATASKAPEKKDAGKKTAPSGDKKKRTKARKETYSSYIYKVLKQVH
PDTGISNRAMSILNSFVNDIFERVATEASKLAAYNKKSTISSREIQTSVRLILPGELAKH
AVSEGTKAVTKYSSSTK
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccaaagctgccgacaagaagcccgccaccaaggcccctgccactgcctccaag
gcccccgagaagaaggacgccggcaagaagaccgcgccctcgggcgacaagaagaagcgg
accaaggcccgcaaggagacttactcctcctacatctacaaggtcctcaagcaggtccac
cccgacaccggtatttccaaccgtgccatgtcgatcctgaactcgtttgtcaacgacatc
tttgagcgtgtcgcgaccgaggcttccaagctggctgcctacaacaagaagtcgaccatc
tcctcccgcgagatccagacgtccgtgcgcctcatcctccccggtgaactcgccaagcac
gccgtgtcggaaggcaccaaggccgtcaccaagtactcgtcgagcaccaaataa

DBGET integrated database retrieval system