KEGG   Thielavia terrestris: THITE_2042100Help
Entry
THITE_2042100     CDS       T02228                                 

Definition
glycoside hydrolase family 11 protein
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ttt  Thielavia terrestris
Brite
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     THITE_2042100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(join(5905185..5905602,5905703..5905944))
Genome map
AA seq 219 aa AA seqDB search
MVHFSILALATSLLVPGVLTAPAAEPAVAIQRRFDGTAFNNWSEGGSNIRCVNGPGGSFT
ANWNSKGGFVCGKGWNGQGARSITFTGTYNATGPGYLSIYGWTTNPLIEYYIVENHADLA
PNEPWTLKGNVTSDGGTYDIYTATRINQPSIVGTATFQQFWSVRREKRTGGTVTTPTHFA
AWKALGMNLGTYNSVIVAVEGYTAKGGSGSSGSASITVQ
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggtccacttctcgattcttgccctggcgacaagcctcctggtgccaggtgtgcttacc
gcacctgctgccgagcctgcagtcgctatccagcgacgcttcgacggaaccgccttcaac
aattggtcggaaggcggcagcaacatccgatgtgtcaacggccccggcgggtctttcacc
gcaaactggaacagcaagggcggtttcgtctgtggtaaagggtggaacgggcaaggcgcg
aggagcatcacgttcaccggcacctacaacgccacgggcccgggctacctgtccatctac
ggctggacgacgaacccgctgatcgagtactacatcgtcgagaaccacgcggacctcgcg
ccgaacgagccgtggacgctcaagggcaacgtcacgtcggacggcggcacgtacgacatc
tacacggccacgcgcatcaaccagccgtccatcgtgggcaccgccacattccagcagttc
tggtccgtccggcgggagaagcgcaccggcggcaccgtgaccacgcccacccacttcgcc
gcctggaaggccctgggcatgaatctgggcacctacaactccgtcatcgtcgccgtcgag
ggctacaccgccaagggcggctcgggcagcagcggctctgccagcatcacggtgcaataa

DBGET integrated database retrieval system