KEGG   Thielavia terrestris: THITE_2047170Help
Entry
THITE_2047170     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
ttt  Thielavia terrestris
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    THITE_2047170
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     THITE_2047170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:4125926..4127515
Genome map
AA seq 529 aa AA seqDB search
MNGAGFVAAADSRTPGSTGTGGIGGLLQASTYLAGLSGGGWLVSSIYANNFTSVVTLRDG
RKDSSIWKFDNSIFTGPDLPGILDTARYWSEVASQVQAKADAGFQTSVTDYWGRALSYQL
IDAPEGGPSYTFSSIAEDDAFSNAQAPFPILVADNRAPGTTVVSLNSTVFEFNPYEMGSW
DPTTFGFVPIRYLASNFSGGVVPAGGECVRGFDSVSYIFGTSSSLFNAFLLQNITSVKGV
PQFLVDAATDILKGLSNARDDVAQYVPNPFLGWNNASNPTADAFELDLVDGGMDLQNIPL
HPLIQPARAVDVIFAVDSSADTTYSWPNGTAMRATYARSQSPIANGTLFPAVPDDRTFLA
LGLNNRPTFFGCDAHNFTTTTSQSAPPPLVVYLPNAPYTALSNATTFTPSYALAQRDAII
RNGYDAATQGNGTLDAAWPACVACAVLSRSWARTGTAAPQACDACFARYCWNGTTAPADA
AIVAGGGGAEYQPTLKIGDGNSASSAGVALAGRSVWALIVGLAAVLFSV
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgaacggcgccggcttcgtggctgctgccgacagccgcaccccgggctccacgggcacc
ggcggcatcggcgggctcctccaggccagcacctacctggccggcctctcgggcggcggc
tggctggtgagcagcatctacgccaacaacttcacctcggtcgtgacgctgcgcgacggc
aggaaggacagcagcatctggaagttcgacaactccatcttcaccggcccggacctgccc
ggcatcttagacacggccaggtactggagcgaggttgccagccaggtccaggccaaggcc
gacgccggcttccagacctccgtcacggactactggggcagggcgctctcgtaccagctg
atcgacgccccggagggcggcccgtcctacaccttctccagcatcgccgaggacgacgcc
ttctcgaacgcccaggccccgtttccgatcctggtcgccgataacagggcccccggcacc
accgtcgtctcgctgaactcgaccgtgttcgagttcaacccctacgagatgggctcgtgg
gaccccaccaccttcggcttcgtcccgatcaggtacctcgcctccaacttctcgggcggc
gtggtgccggccggcggcgagtgcgtccgcggcttcgactcggtcagctacatcttcggc
accagcagctcgctcttcaacgcgttcctgctgcagaacatcacctcggtcaagggcgtg
ccgcagttcctggtcgacgcggccaccgacatcctcaagggcctctccaacgctcgcgac
gacgtggcccagtacgtgccgaacccgttcctgggctggaacaacgcgagcaacccgacg
gcggacgccttcgagctcgacctcgtcgacggcggcatggacctgcagaacatcccgctg
cacccgctgatccagccggcccgcgccgtcgacgtcatcttcgccgtcgactcctccgcc
gacacgacctactcctggcccaacggcaccgccatgcgcgccacctacgcccgctcgcag
agccccatcgccaacggcacgctgttcccggccgtgccggacgaccgcaccttcctggcg
ctgggcctcaacaaccggccgaccttcttcggctgcgacgcgcacaacttcaccaccacc
accagccagtcggcgccgccgccgctggtggtctacctgccgaacgcgccgtacacggcg
ctgtccaacgcgacgaccttcacgccgtcgtacgcgctcgcgcagcgcgacgccatcatc
cgcaacggctacgacgccgcgacgcagggcaacggcacgctcgacgccgcctggcccgcc
tgcgtcgcctgcgccgtgctgagccgcagctgggcgcgcaccggcaccgccgccccgcaa
gcctgcgacgcctgcttcgcgcggtactgctggaacggcacgaccgcgccggccgacgcc
gccatcgtcgccggcggcggcggcgccgagtaccagcccacgctcaagatcggggacggc
aactcggcgagctcggccggtgtggccctggctgggcggtccgtgtgggccttgattgtc
gggctggcggcggtgctgttttctgtgtga

DBGET integrated database retrieval system