KEGG   Thielavia terrestris: THITE_2047529Help
Entry
THITE_2047529     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K10739  replication factor A2
Organism
ttt  Thielavia terrestris
Pathway
ttt03030  DNA replication
ttt03420  Nucleotide excision repair
ttt03430  Mismatch repair
ttt03440  Homologous recombination
Module
ttt_M00288  RPA complex
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    THITE_2047529
   03420 Nucleotide excision repair
    THITE_2047529
   03430 Mismatch repair
    THITE_2047529
   03440 Homologous recombination
    THITE_2047529
DNA replication proteins [BR:ttt03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    THITE_2047529
DNA repair and recombination proteins [BR:ttt03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     THITE_2047529
   MMR (mismatch exicision repair)
     THITE_2047529
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     THITE_2047529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RPA_C tRNA_anti-codon RMI2 DUF2967 Pfg27 CDC24_OB3
Motif
Other DBs
NCBI-GeneID: 11518100
NCBI-ProteinID: XP_003653165
JGI: Thite2_2047529
UniProt: G2R3X7
Position
2:complement(7108580..>7109299)
Genome map
AA seq 239 aa AA seqDB search
DDSLRPVTIKQLIECKEAYPGADLAVDGVPTTQVTLVGQVRSVNPQAVNVTYRIDDGTGV
IDVKKWIDADKADNTPRFAPDTYVRVFGRLSSFNGRKHVGAHYIRAIDDFNEVNYHLLEA
TYVHLCLTKGGLADLQQQQQQQQQQQVGDDGGDSMFVDGGYGAGGGISSDGPPRLSVCSR
NARTMYNYLVNTPGDSQHINQISAGTGLPVRDVLAASAELLDNGLIYTTDDDVTWAVME
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
gatgacagccttcgcccggtaaccatcaagcagctgatcgagtgcaaagaagcctacccg
ggcgccgacctggccgtcgacggcgtgccaaccacccaggtgacgctggtcggccaggtg
cgctcggtcaacccgcaggcggtcaacgtgacgtaccgcatcgacgacggcaccggcgtc
atcgacgtgaagaagtggatcgacgccgacaaggccgacaacacgccgcgcttcgccccc
gacacctacgtgcgcgtcttcggccgcctcagcagcttcaacggccggaagcacgtcggc
gcccactacatccgcgccatcgacgacttcaacgaggtcaactaccacctgctcgaggcc
acgtacgtgcatctgtgcttgaccaagggcggcttggcggacctccagcagcagcagcag
cagcagcagcagcagcaagtaggggacgacggcggggatagcatgtttgtggacggcggc
tatggagccggcgggggtatctcgagtgacggcccgccgcggctctccgtctgctcgcgg
aacgcgcgcaccatgtacaactatctggtcaacactccgggcgacagtcagcatatcaac
caaatctccgccggtacgggcctgcccgtcagggatgtcttggcggcgtcggcagaattg
ttggataatgggcttatctacacaacggatgatgatgtgacgtgggcagtcatggaatag

DBGET integrated database retrieval system