KEGG   Thielavia terrestris: THITE_2047529Help
Entry
THITE_2047529     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
ttt  Thielavia terrestris
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    THITE_2047529
   03420 Nucleotide excision repair
    THITE_2047529
   03430 Mismatch repair
    THITE_2047529
   03440 Homologous recombination
    THITE_2047529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(7108580..>7109299)
Genome map
AA seq 239 aa AA seqDB search
DDSLRPVTIKQLIECKEAYPGADLAVDGVPTTQVTLVGQVRSVNPQAVNVTYRIDDGTGV
IDVKKWIDADKADNTPRFAPDTYVRVFGRLSSFNGRKHVGAHYIRAIDDFNEVNYHLLEA
TYVHLCLTKGGLADLQQQQQQQQQQQVGDDGGDSMFVDGGYGAGGGISSDGPPRLSVCSR
NARTMYNYLVNTPGDSQHINQISAGTGLPVRDVLAASAELLDNGLIYTTDDDVTWAVME
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
gatgacagccttcgcccggtaaccatcaagcagctgatcgagtgcaaagaagcctacccg
ggcgccgacctggccgtcgacggcgtgccaaccacccaggtgacgctggtcggccaggtg
cgctcggtcaacccgcaggcggtcaacgtgacgtaccgcatcgacgacggcaccggcgtc
atcgacgtgaagaagtggatcgacgccgacaaggccgacaacacgccgcgcttcgccccc
gacacctacgtgcgcgtcttcggccgcctcagcagcttcaacggccggaagcacgtcggc
gcccactacatccgcgccatcgacgacttcaacgaggtcaactaccacctgctcgaggcc
acgtacgtgcatctgtgcttgaccaagggcggcttggcggacctccagcagcagcagcag
cagcagcagcagcagcaagtaggggacgacggcggggatagcatgtttgtggacggcggc
tatggagccggcgggggtatctcgagtgacggcccgccgcggctctccgtctgctcgcgg
aacgcgcgcaccatgtacaactatctggtcaacactccgggcgacagtcagcatatcaac
caaatctccgccggtacgggcctgcccgtcagggatgtcttggcggcgtcggcagaattg
ttggataatgggcttatctacacaacggatgatgatgtgacgtgggcagtcatggaatag

DBGET integrated database retrieval system