KEGG   Thielavia terrestris: THITE_2049821Help
Entry
THITE_2049821     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
Organism
ttt  Thielavia terrestris
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(join(1403559..1403935,1404013..1404394,1404460..1404655,1404719..1404825))
Genome map
AA seq 353 aa AA seqDB search
MSNAQNRGGARKISFNVSEQYDIQDVVGEGAYGVVCSAIHKPSGQKVAIKKITPFDHSMF
CLRTLREMKLLRYFNHENIISILDIQKPRSYETFNEVYLIQELMETDMHRVIRTQELSDD
HCQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLKVCDFGLARSAASQDDNSGFM
TEYVATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEMLSGKPLFPGKDYHHQLTLILDVL
GTPTMEDYYGIKSRRAREYIRSLPFKKKVPFRTLFPNTSELALDLLEKLLAFNPVKRITV
EEALKHPYLEPYHDPDDEPTAPPIPEEFFDFDKHKDSLSKEQLKQLIYQEIMR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacgcacagaacagaggcggggcccggaagatttccttcaacgtcagcgagcag
tatgacatccaggacgttgtcggcgaaggcgcctatggcgtcgtgtgttctgccatccac
aagccttccgggcagaaggtcgccatcaagaaaatcactccgttcgaccattccatgttc
tgcctgcggacgctgcgcgaaatgaagctgttgcggtatttcaaccacgagaacatcatc
tccatcctcgatatccagaagccgcggagctacgagacgttcaacgaggtctacttaatc
caggaactcatggagacggacatgcatcgcgtgattcggacacaagaactctccgatgac
cactgccagtacttcatctaccagacgttgcgcgctctcaaggcgatgcactcggccaac
gtgctccaccgggacttgaagccgtccaacctgttgctcaacgctaactgcgatctcaag
gtctgcgactttggcctggcccggtcggcagcgtcgcaggatgacaactctggcttcatg
acggaatacgtggcaacgcgttggtaccgtgccccggagatcatgttgaccttcaaggag
tacacaaaggcgatcgacgtctggtctgtgggctgcattctggctgagatgctcagcggc
aagcccctgttcccgggcaaggactaccaccaccagctcacgttgatcctggatgtcctg
ggaacgccgacgatggaggactactacggcatcaagtcgcgccgcgcgcgcgagtacatt
cgatcgctacccttcaagaagaaggtgcccttccggacgctgtttcccaacacgtcggag
ctggccctcgaccttctggaaaagctcctcgcattcaaccccgtcaagcgcatcacggtc
gaggaggccctcaaacatccctacctcgagccgtaccacgacccagatgacgagccaact
gcgcctcctatcccggaggaattcttcgattttgacaagcacaaggatagcctcagcaag
gaacagctgaagcagctgatctaccaggagataatgaggtag

DBGET integrated database retrieval system