KEGG   Thielavia terrestris: THITE_2049821Help
Entry
THITE_2049821     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ttt  Thielavia terrestris
Brite
Enzymes [BR:ttt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     THITE_2049821
Protein kinases [BR:ttt01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   THITE_2049821
Exosome [BR:ttt04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   THITE_2049821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(join(1403559..1403935,1404013..1404394,1404460..1404655,1404719..1404825))
Genome map
AA seq 353 aa AA seqDB search
MSNAQNRGGARKISFNVSEQYDIQDVVGEGAYGVVCSAIHKPSGQKVAIKKITPFDHSMF
CLRTLREMKLLRYFNHENIISILDIQKPRSYETFNEVYLIQELMETDMHRVIRTQELSDD
HCQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLKVCDFGLARSAASQDDNSGFM
TEYVATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEMLSGKPLFPGKDYHHQLTLILDVL
GTPTMEDYYGIKSRRAREYIRSLPFKKKVPFRTLFPNTSELALDLLEKLLAFNPVKRITV
EEALKHPYLEPYHDPDDEPTAPPIPEEFFDFDKHKDSLSKEQLKQLIYQEIMR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacgcacagaacagaggcggggcccggaagatttccttcaacgtcagcgagcag
tatgacatccaggacgttgtcggcgaaggcgcctatggcgtcgtgtgttctgccatccac
aagccttccgggcagaaggtcgccatcaagaaaatcactccgttcgaccattccatgttc
tgcctgcggacgctgcgcgaaatgaagctgttgcggtatttcaaccacgagaacatcatc
tccatcctcgatatccagaagccgcggagctacgagacgttcaacgaggtctacttaatc
caggaactcatggagacggacatgcatcgcgtgattcggacacaagaactctccgatgac
cactgccagtacttcatctaccagacgttgcgcgctctcaaggcgatgcactcggccaac
gtgctccaccgggacttgaagccgtccaacctgttgctcaacgctaactgcgatctcaag
gtctgcgactttggcctggcccggtcggcagcgtcgcaggatgacaactctggcttcatg
acggaatacgtggcaacgcgttggtaccgtgccccggagatcatgttgaccttcaaggag
tacacaaaggcgatcgacgtctggtctgtgggctgcattctggctgagatgctcagcggc
aagcccctgttcccgggcaaggactaccaccaccagctcacgttgatcctggatgtcctg
ggaacgccgacgatggaggactactacggcatcaagtcgcgccgcgcgcgcgagtacatt
cgatcgctacccttcaagaagaaggtgcccttccggacgctgtttcccaacacgtcggag
ctggccctcgaccttctggaaaagctcctcgcattcaaccccgtcaagcgcatcacggtc
gaggaggccctcaaacatccctacctcgagccgtaccacgacccagatgacgagccaact
gcgcctcctatcccggaggaattcttcgattttgacaagcacaaggatagcctcagcaag
gaacagctgaagcagctgatctaccaggagataatgaggtag

DBGET integrated database retrieval system