KEGG   Thielavia terrestris: THITE_2050221Help
Entry
THITE_2050221     CDS       T02228                                 

Definition
hypothetical protein
Organism
ttt  Thielavia terrestris
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(join(4073362..4073449,4073527..4074043,4074148..4074474,4074533..4074632,4074697..4074822))
Genome map
AA seq 385 aa AA seqDB search
MKFALLFAAAVAEAAVVARECTAPGPDEDGRYTISAPGIKAQFIPYGATLTNLFVKDKNG
SDIDVVLGYDDVNYYPKDPSHPVYNAVPGRYANRIGNGRYTIDGVTYHTEQNDGNNTLHS
GTNNWSYRFWNVTAFSADSITFSLLDASNSSLGMLGRVEANVTYSVTKDTWHIKITARSL
DQKTPIMPTQHTYFNLDAYRNPASPKIWDHTLYLPYSPRYLEGDQGALPTGKILTAAPGS
INDFASAPNLTVGHARNLTGFEGNCGANGACEGYNGYWLIDNPPPDADFVARLSSAFSGV
KAELRTNQPGLVLYSCNWMDGTASLKKTQGIPGVNEKVVRSSCIAIEAQDWPDGINHPEW
NRTTAQIYGPGRTLNWESSWTFGLL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgccttgctcttcgctgccgcggtggcagaggctgccgtcgtcgcccgagaa
tgcaccgccccggggccggatgaagatgggcggtacaccatttctgcgccgggaatcaag
gcgcagttcatcccctatggcgcgaccctgacgaacctcttcgtcaaggacaagaacggc
agcgacattgacgtggtgctcggctacgacgatgtcaactactatcccaaggaccccagc
caccccgtgtacaacgccgtgcctggccggtacgccaaccggatcggcaacgggcggtac
acgatcgacggggtaacgtaccacacggagcagaacgacggcaacaacacgctgcacagc
ggcaccaacaactggtcgtaccgcttctggaacgtgacggccttctcggccgactcgatc
accttctcgctgctggacgcgtccaactcgtcgctgggcatgctcggccgcgtcgaggcc
aatgtcacgtacagcgtgaccaaggacacctggcacatcaagatcaccgcccggtcgctg
gaccagaagacgcccatcatgcccacgcagcacacgtacttcaacctggatgcgtaccgc
aaccctgccagccccaagatctgggaccacacgctgtacctgccctactcgccgcggtac
ctggagggcgaccaaggggcgctgccgacgggcaagatcctgacggcggcgccggggtcg
atcaacgacttcgcgtcggcgccgaacctcacggtcgggcacgcgcgcaacctgaccggg
ttcgagggcaactgcggcgccaacggcgcctgcgagggctacaacggctactggctgatc
gacaacccgcccccggacgcggacttcgtcgcgcgcctgtcgagcgccttctccggcgtc
aaggccgagctgcgcaccaaccagcccggcctggtgctctactcgtgcaactggatggac
ggcacggccagcctgaagaagacgcagggcatccccggggtcaatgagaaggttgtccgg
agcagctgcatcgcgatcgaggctcaggactggccggatggcattaaccatcccgagtgg
aaccgtaccacggcgcagatctacggtccgggccggacgctcaactgggagagctcgtgg
acctttggcctgctttga

DBGET integrated database retrieval system