KEGG   Thielavia terrestris: THITE_2053799Help
Entry
THITE_2053799     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ttt  Thielavia terrestris
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ttt00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4:complement(join(1635359..1635508,1635652..1636174,1636252..1636333,1636394..1636547))
Genome map
AA seq 302 aa AA seqDB search
MADSLLARKYIDGIYIPVGLLVLGTSIVKREWTVYALLLGIALGAVKYIKSAPKKVLKPD
VFQEFELKEKTIISHNVAIYRFALPSPTSILGLPIGQHISIGATLPQPDGSSKEIVRSYT
PISGDDQPGYFDLLIKSYPQGNISRHMASLAVGQTIRVKGPKGAFVYTPNMVRHFGMIAG
GTGITPMLQIIKAIARGRKAGDTTQVDLIFANVTEQDILLREDLDQLAREDKGFRVHYVL
DKPPAGWQGGVGYKWLPKPADDVKILLCGPPPMISGLKKATESLGYKKARPVSKLEDQVF
AF
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggccgactctctgcttgcgcggaagtatattgacggcatatatatcccggttggcctg
ctcgtcctcgggacctccatcgtgaagcgggagtggacggtgtacgccctgctgctgggg
atcgctctcggcgcggtcaaatacataaaatctgcacccaaaaaggtcctcaagcccgat
gttttccaagagttcgagctcaaggagaagaccatcatctcgcacaatgtcgccatctac
cgcttcgccctcccgagcccgacctccatcctcggcctgcccatcggccagcacatctcc
atcggcgcgaccctgccgcagcccgacggcagcagcaaggagatcgtgcggtcctacacg
ccgatctcgggcgacgaccagccgggctacttcgacctcctgatcaagtcgtacccgcag
ggcaacatctcgcggcacatggcctcgctggcggtcggccagacgatccgcgtcaagggc
cccaagggcgccttcgtgtacacgcccaacatggtgcggcacttcggcatgatcgccggc
ggcaccggcatcacgccgatgctgcagatcatcaaggccatcgcgcgcggccgcaaggcc
ggcgacaccacccaggtcgacctcatcttcgccaacgtcaccgagcaggacatcctgctg
cgcgaggacctcgaccagctcgcgcgcgaggacaagggcttccgcgtgcactacgtgctg
gacaagccgccggccggctggcagggcggcgtgggctacaaatggctgcccaagcctgcc
gacgacgtcaagatcctgctgtgcggcccgccgcccatgatcagcggcctgaagaaggcc
acagagagcctcggctacaagaaggccaggcccgtgagcaagttggaggaccaggtgttc
gccttctaa

DBGET integrated database retrieval system