KEGG   Thielavia terrestris: THITE_2058212Help
Entry
THITE_2058212     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ttt  Thielavia terrestris
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    THITE_2058212
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    THITE_2058212
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    THITE_2058212
Enzymes [BR:ttt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     THITE_2058212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6:complement(join(596105..597079,597160..597738,597844..597933))
Genome map
AA seq 547 aa AA seqDB search
MSNGAVTNGSSGQTHTESQRYLSTRGDDSGLSFEEVVLKGLASDGGLYIPHEIPAAEQWE
SWKDLSFVDLAFNVLSLYISPSEIPAEDLKDIIRRSYATFRSPDVTPLIQLQGNIHLLEL
FHGPTFAFKDVALQFLGNLFEYFLVRRNEGKTGRDRYHLTVVGATSGDTGSAAIYGLRGK
KDVSVFMLHPKGRVSPIQELQMTTVLDANVHNLAVTGNFDNCQDIVKALFADPDINSSHK
LGAVNSINWARILAQTVYYFYSYFSLARQQPDSFKIGDKVRFVVPTGNFGDILAGYFAHR
MGLPVDKLVIATNENDILDRFWKTGRYEKKPAYGAAAEGGLPADGVKAHEDGVKETLSPA
MDILVSSNFERLLWFLAYEFASSAGMDDEWNKKQAGQEVSAWLADLKTKGGFGPVYKDVL
EAARRTFESERVSDQQTLDTIRSLYKEVGYVLDPHTAVGVEAARRSAARAPGVPTIALST
AHPAKFAGAVTLALRDEPGFEFDAKVLPPEFVGLDKKEKRVRDVANDWTAVRELVKQEVE
EELKGLR
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacggcgctgtcacgaacggctcctccggccagacgcacaccgagtcgcagcgc
tacttgagcacgcggggcgacgacagcggtctctccttcgaggaggtcgtcctcaagggc
ctcgcctccgacggcggtctgtacattccccatgagattcccgccgccgagcaatgggag
tcctggaaggacctctcgttcgttgatcttgccttcaacgtcctgtcgctctacatctcg
ccctccgagatcccggccgaggacctcaaggacatcatccgccgcagctacgccactttc
cggtcccccgacgtcaccccgctcatccagctgcaggggaacatccacctgctagagctc
ttccacgggccgacattcgccttcaaggatgtggcgctacagttcctcggcaaccttttc
gagtactttttggtgcgccggaacgagggcaagacggggcgggacaggtatcacctcacc
gtggtgggcgctaccagcggcgacacgggctcggccgccatctacggcctgcgggggaag
aaggatgtctccgtcttcatgctccatcccaagggccgcgtgagccccattcaagaactc
cagatgactacggtgctcgacgccaacgtccacaacctcgccgtgacgggcaacttcgac
aattgccaggacatcgtcaaggctctgttcgccgaccccgacatcaactccagccacaag
ctcggcgccgtcaactcgatcaactgggcgcgcatcctcgcccagaccgtctactacttc
tactcgtacttctcgctcgcccgccaacaacccgactcgttcaagatcggcgacaaggtg
cgcttcgtcgtcccgacgggcaacttcggcgacatcttggccggctactttgcccaccgc
atgggcctgcccgtcgacaaactcgtcatcgcgaccaacgagaacgacatcctcgaccgg
ttctggaagacgggccggtacgagaagaagcccgcgtacggcgccgcggccgagggcggc
ctccccgcggacggcgtcaaggcgcacgaggacggcgtcaaggagacgctgtcgccggcc
atggacatcctcgtgtcctccaacttcgagcgcttgctctggttcctcgcctacgagttc
gcgtccagcgccggcatggacgacgaatggaacaagaagcaggccggccaggaggtctcg
gcctggctcgccgacctcaagaccaagggcggcttcggccccgtctacaaggacgtgctc
gaggccgcccgccgcaccttcgagagcgagcgcgtcagcgaccagcagaccctcgacacc
atccgcagcctgtacaaggaggtcggctacgtgctggacccgcacacggccgtcggcgtc
gaggccgcgaggcggtcggccgcgcgcgcccccggcgtgcccaccatcgcgctgtcgacc
gcgcacccggccaagttcgccggcgccgtgacgctcgccctgcgggacgagcccggcttc
gagttcgacgccaaggtgctcccgcccgagttcgtcgggctcgacaagaaggagaagagg
gtccgcgacgtggccaacgactggaccgccgtgcgggagctggtcaagcaggaggtcgag
gaggagctgaaggggctgaggtga

DBGET integrated database retrieval system