KEGG   Thielavia terrestris: THITE_2068692Help
Entry
THITE_2068692     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
ttt  Thielavia terrestris
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    THITE_2068692
Enzymes [BR:ttt01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     THITE_2068692
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     THITE_2068692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4:join(2813279..2813308,2813387..2813758,2813845..2813961)
Genome map
AA seq 172 aa AA seqDB search
MKAYLYDNLPGDQRLPHDSGTALTPAELGTLGVLYYQIDSVVGVDALAAERGYKNRDEIT
VSPEKMGDAYEAKVRMFFDEHLHEDEEIRYVRDGAGYFDVRDRADRWVRIRVEKDDLIIL
PAGIYHRFTTDENNYIHAMRLFKEEPKWTPLNRSEDLDSNPYRKEYVSQYLS
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcctacctctacgacaacctccccggcgaccagcggctgccgcacgactcgggc
accgcgctgacgccggcggagctcggcacgctcggcgtgctatactaccagatcgactcg
gtggtgggcgtggacgcgctggcggcggagcgcgggtacaagaaccgggacgagatcacg
gtgtcgccggagaagatgggcgacgcgtacgaggccaaggtgcgcatgttcttcgacgag
cacctgcacgaggacgaggagatccggtacgtgcgggacggcgccggctacttcgacgtg
cgcgaccgcgccgaccgctgggtgcgcatccgcgtcgagaaggacgacctgatcatcctg
ccggccggcatctaccaccggttcacgaccgacgagaacaattacatccacgcgatgcgc
ctgttcaaggaggagcccaagtggacgcccctgaacaggtcagaggacctcgactcgaac
ccgtaccggaaggagtacgtttctcagtacctgtcgtag

DBGET integrated database retrieval system