KEGG   Thielavia terrestris: THITE_2077826Help
Entry
THITE_2077826     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
ttt  Thielavia terrestris
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ttt01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:ttt00062]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(join(5305368..5306218,5306291..5306417))
Genome map
AA seq 325 aa AA seqDB search
MAFFLRLTLLAIGLLVATSIAKPVERRFEDEDDTPLPLVIWHGLGDTFNSEGMARVVSIA
EDVHPGIFVYPIRMDDDPSRDRFDSFVGNVTDHVAKACADIAADPILSTAPAIDALGFSQ
GGQFLRAYVERCNKPPVRSLITFGSQHNGITTFRECAVTDWVCRIAMAALKGDVWSQAVQ
SKLVPAQYYRNPDEYEQYLEHSNFLADINNERATKNEAYKKNIEKLESFVMYMFEEDKTV
IPKESAWFGEVNGTESTPLRARKLYSEDWLGLRALDRKGGLKFRTAPGEHMKLSEELLKE
AFAEFYGPLKRSSASRPRPGGGDDL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggccttctttctccgactgacgctgctcgctatcgggctgcttgtcgcaacctcgatt
gcgaagcccgttgagcgtcgtttcgaggatgaggacgacaccccgttgccgctcgtgatt
tggcacggccttggcgacaccttcaacagcgagggaatggcgcgcgtcgtctcgatcgcc
gaggatgtccaccccggaatcttcgtctacccgattcgcatggatgatgacccctcgcgt
gaccggttcgactccttcgtgggcaacgtgactgatcatgtcgccaaagcctgcgccgac
atcgccgcggacccgatcctgtcgaccgcccccgcaatcgatgccctcggcttctcccag
ggcggccaattcctgcgcgcctacgtcgagcgatgcaataagccccccgtccgcagcctc
atcactttcggctcgcagcacaatggcatcaccaccttccgtgaatgtgctgtgaccgac
tgggtctgccgcatcgcgatggccgcgctgaagggcgatgtctggagccaggcggtgcag
agcaagctggtgcccgcgcagtactaccgcaacccggacgagtacgagcagtacctggag
cattccaacttcctcgcggacatcaacaacgagcgggcgacgaagaacgaggcgtacaag
aagaacattgaaaagctcgagagcttcgtcatgtacatgttcgaggaggataagactgtc
atcccgaaggagtcggcctggttcggcgaggtcaacggcactgagagcacgccgctgcgc
gcgcgtaagctgtactcggaggattggctcggcctgcgcgctctcgaccgcaagggcggg
ctcaagttccgcacggcacccggcgagcacatgaagctgtcggaagagttgttgaaggag
gcctttgccgagttttacgggccgctgaagcgtagctcggcgtcgcgcccgcggccgggg
ggtggcgatgacctttga

DBGET integrated database retrieval system