KEGG   Thielavia terrestris: THITE_2077826Help
Entry
THITE_2077826     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
ttt  Thielavia terrestris
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    THITE_2077826
  Lipid metabolism
   00062 Fatty acid elongation
    THITE_2077826
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     THITE_2077826
Lipid biosynthesis proteins [BR:ttt01004]
 Fatty acid synthase
  Component type
   THITE_2077826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(join(5305368..5306218,5306291..5306417))
Genome map
AA seq 325 aa AA seqDB search
MAFFLRLTLLAIGLLVATSIAKPVERRFEDEDDTPLPLVIWHGLGDTFNSEGMARVVSIA
EDVHPGIFVYPIRMDDDPSRDRFDSFVGNVTDHVAKACADIAADPILSTAPAIDALGFSQ
GGQFLRAYVERCNKPPVRSLITFGSQHNGITTFRECAVTDWVCRIAMAALKGDVWSQAVQ
SKLVPAQYYRNPDEYEQYLEHSNFLADINNERATKNEAYKKNIEKLESFVMYMFEEDKTV
IPKESAWFGEVNGTESTPLRARKLYSEDWLGLRALDRKGGLKFRTAPGEHMKLSEELLKE
AFAEFYGPLKRSSASRPRPGGGDDL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggccttctttctccgactgacgctgctcgctatcgggctgcttgtcgcaacctcgatt
gcgaagcccgttgagcgtcgtttcgaggatgaggacgacaccccgttgccgctcgtgatt
tggcacggccttggcgacaccttcaacagcgagggaatggcgcgcgtcgtctcgatcgcc
gaggatgtccaccccggaatcttcgtctacccgattcgcatggatgatgacccctcgcgt
gaccggttcgactccttcgtgggcaacgtgactgatcatgtcgccaaagcctgcgccgac
atcgccgcggacccgatcctgtcgaccgcccccgcaatcgatgccctcggcttctcccag
ggcggccaattcctgcgcgcctacgtcgagcgatgcaataagccccccgtccgcagcctc
atcactttcggctcgcagcacaatggcatcaccaccttccgtgaatgtgctgtgaccgac
tgggtctgccgcatcgcgatggccgcgctgaagggcgatgtctggagccaggcggtgcag
agcaagctggtgcccgcgcagtactaccgcaacccggacgagtacgagcagtacctggag
cattccaacttcctcgcggacatcaacaacgagcgggcgacgaagaacgaggcgtacaag
aagaacattgaaaagctcgagagcttcgtcatgtacatgttcgaggaggataagactgtc
atcccgaaggagtcggcctggttcggcgaggtcaacggcactgagagcacgccgctgcgc
gcgcgtaagctgtactcggaggattggctcggcctgcgcgctctcgaccgcaagggcggg
ctcaagttccgcacggcacccggcgagcacatgaagctgtcggaagagttgttgaaggag
gcctttgccgagttttacgggccgctgaagcgtagctcggcgtcgcgcccgcggccgggg
ggtggcgatgacctttga

DBGET integrated database retrieval system