KEGG   Thielavia terrestris: THITE_2080461Help
Entry
THITE_2080461     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ttt  Thielavia terrestris
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    THITE_2080461
   00670 One carbon pool by folate
    THITE_2080461
Enzymes [BR:ttt01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     THITE_2080461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4:join(3102512..3102655,3102815..3102947,3103092..3103432)
Genome map
AA seq 205 aa AA seqDB search
MPSLPDLTLIVAATQQMGIGRHGTLPWTGLKKEMAYFARVTKRLPPGPQNAVIMGRRTWE
SIPARFRPLPGRVNVVVSRSWAAAAAAAATASMAGSLEEALRMLGERQQQQQQAIGRVFV
IGGAQIYAAALARREARRVLLTRVRSEFECDTFFPVRLAEGGNGDGGWRRSGQAEMDAWV
GEEVPRGVQSEAGTEYEFEMWERVD
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgccatcactcccggacctcaccctcatcgtggccgccacccagcaaatgggcatcggc
cgccacggcacgctgccctggaccggcctcaagaaggagatggcctacttcgcgcgcgtc
accaagcgcctcccccctgggccccaaaacgcggtcatcatgggccgcaggacgtgggag
agcattccggcgcggttccggccgctgccggggcgggtgaacgtggttgtttcgcggtcg
tgggcggctgctgctgccgccgctgctactgctagcatggccggcagcctggaggaggcg
ctgcggatgctcggggagaggcagcagcagcagcagcaggcgatcgggcgggtgtttgtc
attggcggcgcgcagatctatgccgcggcgctggcgcggcgggaggcgcggcgggtgctg
ctcacgcgggtgcgcagcgagttcgagtgcgacaccttcttccccgtgaggttggcagaa
ggggggaatggcgacgggggctggcgcaggagcggccaggcagagatggatgcgtgggtc
ggcgaggaggtgccgcgcggcgtgcagagcgaggcgggtacggagtacgagtttgagatg
tgggagcgggtggattag

DBGET integrated database retrieval system