KEGG   Thielavia terrestris: THITE_2080461Help
Entry
THITE_2080461     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ttt  Thielavia terrestris
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ttt00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ttt00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4:join(3102512..3102655,3102815..3102947,3103092..3103432)
Genome map
AA seq 205 aa AA seqDB search
MPSLPDLTLIVAATQQMGIGRHGTLPWTGLKKEMAYFARVTKRLPPGPQNAVIMGRRTWE
SIPARFRPLPGRVNVVVSRSWAAAAAAAATASMAGSLEEALRMLGERQQQQQQAIGRVFV
IGGAQIYAAALARREARRVLLTRVRSEFECDTFFPVRLAEGGNGDGGWRRSGQAEMDAWV
GEEVPRGVQSEAGTEYEFEMWERVD
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgccatcactcccggacctcaccctcatcgtggccgccacccagcaaatgggcatcggc
cgccacggcacgctgccctggaccggcctcaagaaggagatggcctacttcgcgcgcgtc
accaagcgcctcccccctgggccccaaaacgcggtcatcatgggccgcaggacgtgggag
agcattccggcgcggttccggccgctgccggggcgggtgaacgtggttgtttcgcggtcg
tgggcggctgctgctgccgccgctgctactgctagcatggccggcagcctggaggaggcg
ctgcggatgctcggggagaggcagcagcagcagcagcaggcgatcgggcgggtgtttgtc
attggcggcgcgcagatctatgccgcggcgctggcgcggcgggaggcgcggcgggtgctg
ctcacgcgggtgcgcagcgagttcgagtgcgacaccttcttccccgtgaggttggcagaa
ggggggaatggcgacgggggctggcgcaggagcggccaggcagagatggatgcgtgggtc
ggcgaggaggtgccgcgcggcgtgcagagcgaggcgggtacggagtacgagtttgagatg
tgggagcgggtggattag

DBGET integrated database retrieval system