KEGG   Thielavia terrestris: THITE_2081505Help
Entry
THITE_2081505     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K03259  translation initiation factor 4E
Organism
ttt  Thielavia terrestris
Pathway
ttt03013  RNA transport
Module
ttt_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    THITE_2081505
Messenger RNA biogenesis [BR:ttt03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     THITE_2081505
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     THITE_2081505
Translation factors [BR:ttt03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    THITE_2081505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 11522415
NCBI-ProteinID: XP_003656561
JGI: Thite2_2081505
UniProt: G2REU2
Position
5:join(1596584..1596778,1596846..1596917,1596976..1597464)
Genome map
AA seq 251 aa AA seqDB search
MSEQVDLTTIPISPEGSNDPNGAAAEAAEDANKTITVFHDKDNFNVKHPLSCRWTLWFTK
PASGKGDNWNDLLKEVITFESVEEFWGVYNNIAPVSELALKSDYHLFKEGVRPEWEDPQN
KHGGKWSFQFKEKRSVNIDELWLHTMLAAIGETLEDEEDGEVMGVVVNVRKAFYRIGVWT
RTTGRHIPGRGDADVAGGKGRSAEKGKEILMSIGRRFKNVLKLPPNEMLEFSGHTDSAHS
GSTRAKAKMVV
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagcaggtcgatctcaccaccattcccatctcgcccgagggcagcaacgatccc
aatggcgccgccgccgaggccgcagaggatgccaacaagaccatcaccgtcttccacgac
aaggacaacttcaatgtcaaacaccccctctcatgtcggtggacgctctggtttacaaag
cccgccagcggaaagggtgacaactggaacgacctgctgaaggaggtgatcacatttgag
tctgtcgaggaattctggggcgtctataacaacatcgcacccgtctccgagcttgctctc
aagtctgattatcacctcttcaaggagggcgtgcggccggagtgggaagatcctcagaat
aagcacggaggaaagtggtcgtttcaattcaaggagaagcggtcggtcaacattgacgag
ctgtggctgcacaccatgctcgccgccatcggcgagacgctggaggacgaggaggacggc
gaggtgatgggcgttgtcgtcaacgtccgcaaggcgttctaccgtattggcgtatggacc
cgtaccacgggccgccacattcccggccgcggggacgctgacgtcgcgggcggcaaaggc
cggtcggcggagaagggcaaagagatcctgatgtctatcggccggcggttcaagaatgtt
ctcaagctgccgcccaacgagatgcttgaattctcgggacataccgacagcgcccatagc
ggaagcacacgcgctaaggcgaagatggtggtgtaa

DBGET integrated database retrieval system