KEGG   Thielavia terrestris: THITE_2081505Help
Entry
THITE_2081505     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
ttt  Thielavia terrestris
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:ttt03013]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5:join(1596584..1596778,1596846..1596917,1596976..1597464)
Genome map
AA seq 251 aa AA seqDB search
MSEQVDLTTIPISPEGSNDPNGAAAEAAEDANKTITVFHDKDNFNVKHPLSCRWTLWFTK
PASGKGDNWNDLLKEVITFESVEEFWGVYNNIAPVSELALKSDYHLFKEGVRPEWEDPQN
KHGGKWSFQFKEKRSVNIDELWLHTMLAAIGETLEDEEDGEVMGVVVNVRKAFYRIGVWT
RTTGRHIPGRGDADVAGGKGRSAEKGKEILMSIGRRFKNVLKLPPNEMLEFSGHTDSAHS
GSTRAKAKMVV
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagcaggtcgatctcaccaccattcccatctcgcccgagggcagcaacgatccc
aatggcgccgccgccgaggccgcagaggatgccaacaagaccatcaccgtcttccacgac
aaggacaacttcaatgtcaaacaccccctctcatgtcggtggacgctctggtttacaaag
cccgccagcggaaagggtgacaactggaacgacctgctgaaggaggtgatcacatttgag
tctgtcgaggaattctggggcgtctataacaacatcgcacccgtctccgagcttgctctc
aagtctgattatcacctcttcaaggagggcgtgcggccggagtgggaagatcctcagaat
aagcacggaggaaagtggtcgtttcaattcaaggagaagcggtcggtcaacattgacgag
ctgtggctgcacaccatgctcgccgccatcggcgagacgctggaggacgaggaggacggc
gaggtgatgggcgttgtcgtcaacgtccgcaaggcgttctaccgtattggcgtatggacc
cgtaccacgggccgccacattcccggccgcggggacgctgacgtcgcgggcggcaaaggc
cggtcggcggagaagggcaaagagatcctgatgtctatcggccggcggttcaagaatgtt
ctcaagctgccgcccaacgagatgcttgaattctcgggacataccgacagcgcccatagc
ggaagcacacgcgctaaggcgaagatggtggtgtaa

DBGET integrated database retrieval system