KEGG   Thielavia terrestris: THITE_2081505Help
Entry
THITE_2081505     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
ttt  Thielavia terrestris
Pathway
RNA transport
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    THITE_2081505
Translation factors [BR:ttt03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    THITE_2081505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5:join(1596584..1596778,1596846..1596917,1596976..1597464)
Genome map
AA seq 251 aa AA seqDB search
MSEQVDLTTIPISPEGSNDPNGAAAEAAEDANKTITVFHDKDNFNVKHPLSCRWTLWFTK
PASGKGDNWNDLLKEVITFESVEEFWGVYNNIAPVSELALKSDYHLFKEGVRPEWEDPQN
KHGGKWSFQFKEKRSVNIDELWLHTMLAAIGETLEDEEDGEVMGVVVNVRKAFYRIGVWT
RTTGRHIPGRGDADVAGGKGRSAEKGKEILMSIGRRFKNVLKLPPNEMLEFSGHTDSAHS
GSTRAKAKMVV
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtcggagcaggtcgatctcaccaccattcccatctcgcccgagggcagcaacgatccc
aatggcgccgccgccgaggccgcagaggatgccaacaagaccatcaccgtcttccacgac
aaggacaacttcaatgtcaaacaccccctctcatgtcggtggacgctctggtttacaaag
cccgccagcggaaagggtgacaactggaacgacctgctgaaggaggtgatcacatttgag
tctgtcgaggaattctggggcgtctataacaacatcgcacccgtctccgagcttgctctc
aagtctgattatcacctcttcaaggagggcgtgcggccggagtgggaagatcctcagaat
aagcacggaggaaagtggtcgtttcaattcaaggagaagcggtcggtcaacattgacgag
ctgtggctgcacaccatgctcgccgccatcggcgagacgctggaggacgaggaggacggc
gaggtgatgggcgttgtcgtcaacgtccgcaaggcgttctaccgtattggcgtatggacc
cgtaccacgggccgccacattcccggccgcggggacgctgacgtcgcgggcggcaaaggc
cggtcggcggagaagggcaaagagatcctgatgtctatcggccggcggttcaagaatgtt
ctcaagctgccgcccaacgagatgcttgaattctcgggacataccgacagcgcccatagc
ggaagcacacgcgctaaggcgaagatggtggtgtaa

DBGET integrated database retrieval system