KEGG   Thielavia terrestris: THITE_2082381Help
Entry
THITE_2082381     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K04441  
p38 MAP kinase [EC:2.7.11.24]
Organism
ttt  Thielavia terrestris
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:ttt04011]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5:complement(join(4151365..4151440,4151511..4151694,4151758..4151836,4151914..4152270,4152361..4152460,4152527..4152570,4152634..4152763,4152838..4152885,4152941..4152996))
Genome map
AA seq 357 aa AA seqDB search
MAEFVRAQIFGTTFEITSRYSDLQPVGMGAFGLVCSAKDQLTNQNVAIKKIMKPFSSPVL
AKRTYRELKLLKHLKHENVISLSDIFISPLEDIYFVTELLGTDLHRLLTSRPLEPQFVQY
FLYQIMRGLKYVHSAGVVHRDLKPSNILVNENCDLKICDFGLARIQDPQMTGYVSTRYYR
APEIMLTWQKYDVEVDIWSAGCIFAEMIGGKPLFPGKDHVNQFSIITELLGTPPDDVINT
IASENTLRFVKSLPRRERQPLKNKFKDADPPAIDLLERMLVFDPKKRITAAEALAHEYLA
PYHDPTDEPVAEEKFDWSFNDADLPVDTWKIMMYSEILDYHNVEAANVPPQDFYVAQ
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggccgagttcgtgcgcgcccaaatctttgggaccacctttgagatcacctcgaggtat
tccgacctccagcctgtgggcatgggggcgttcggtttggtttgctctgcaaaagaccag
ctcacgaaccagaatgtcgcgatcaagaagatcatgaagcccttcagctccccggtgctc
gctaaaaggacataccgcgaattgaagctgctgaagcacctgaagcacgagaacgtcatc
tcgctgagcgatatcttcatttccccgctcgaggacatctactttgtcaccgaactgctg
ggcaccgatctccacaggctgctcacctccaggccgctggagccgcagttcgtccagtac
tttctctaccagatcatgcgaggtctgaaatacgtccattcggctggcgtcgtccaccga
gacctgaaacccagcaacatcttggtcaacgagaactgcgacttgaagatttgcgacttc
ggccttgcgcgcatccaagatccccagatgaccggctacgtgtcgacgaggtactaccga
gcgcccgagatcatgctcacatggcagaagtacgacgtcgaagtggacatttggagcgcg
ggctgcatcttcgccgagatgattggggggaagccgctctttcccggcaaggaccatgtc
aaccagttctccatcatcacggagctcctgggaacgccgcccgatgatgttatcaacacc
atcgcgagcgagaacaccctgagattcgtcaagtccctgccgcgacgcgagaggcagccg
ctcaagaacaagttcaaggacgctgatccaccggccattgacctcttggagcggatgctc
gtcttcgaccccaagaagcggataacagcggccgaggcgctggctcacgagtacctcgcc
ccctaccacgaccctacggatgagccggtcgccgaagagaagttcgactggagcttcaac
gacgccgacctgcctgtggatacgtggaagatcatgatgtactcggagattctcgactac
cacaacgtcgaagcggccaacgtccccccacaggacttctatgtggcccaatga

DBGET integrated database retrieval system