KEGG   Thielavia terrestris: THITE_2082804Help
Entry
THITE_2082804     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
ttt  Thielavia terrestris
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ttt00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ttt00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:ttt03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ttt03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:ttt03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:ttt03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ttt03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6:join(1086584..1087039,1087167..1087346)
Genome map
AA seq 211 aa AA seqDB search
MPTTRRSSRPAVGAGKQSTLSFKHKVTKAIKTGKEGYKSPSRAKEYIPAPSPEPATTDEK
PAPSPSSSDDSRLKQIEQQQLKQQQPPTAAAADEETDPDRRAAAQVTDAAIERYWAGIEA
GRRARAVHRKHAEGLSTGEKVLRYFDVSSQYGPCIGISRIKRWQRAQRLGLKPPIEVLAV
LLKEEAQGNAGIQRAHMDELLNSTAVGSVGV
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccacccgcagatcgtctcggcccgccgtgggcgcaggcaagcagtcgacgctc
agcttcaagcacaaagtcaccaaggccatcaagaccggcaaggaaggctacaaatcgcca
tctcgcgcaaaagaatacatccccgcaccctcgcccgaaccagccaccaccgacgagaag
ccagccccctccccctcctcctccgacgacagccgactcaaacagatcgagcagcagcag
ctgaagcagcagcagccgccgacagcggcggcggcagacgaggagaccgatccggaccgc
cgcgccgccgcgcaggtcacggatgcggcgattgagcggtactgggcgggcatcgaggcc
gggcgccgcgcgcgcgcggtgcaccggaagcacgccgagggcctgagcacgggcgagaag
gtgctgcggtactttgacgtgagctcgcagtacgggccctgcatcggtatttccaggatc
aagcggtggcagcgggcgcagaggctcgggctgaagccgccgattgaggtgctggcggtg
ctgttgaaggaggaggcgcaggggaatgcgggcatccagagggcccatatggacgagctt
ctgaactcgactgcggtgggctccgttggggtctga

DBGET integrated database retrieval system