KEGG   Thielavia terrestris: THITE_2082804Help
Entry
THITE_2082804     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
ttt  Thielavia terrestris
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    THITE_2082804
   00240 Pyrimidine metabolism
    THITE_2082804
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    THITE_2082804
   03410 Base excision repair
    THITE_2082804
   03420 Nucleotide excision repair
    THITE_2082804
   03430 Mismatch repair
    THITE_2082804
   03440 Homologous recombination
    THITE_2082804
DNA repair and recombination proteins [BR:ttt03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      THITE_2082804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6:join(1086584..1087039,1087167..1087346)
Genome map
AA seq 211 aa AA seqDB search
MPTTRRSSRPAVGAGKQSTLSFKHKVTKAIKTGKEGYKSPSRAKEYIPAPSPEPATTDEK
PAPSPSSSDDSRLKQIEQQQLKQQQPPTAAAADEETDPDRRAAAQVTDAAIERYWAGIEA
GRRARAVHRKHAEGLSTGEKVLRYFDVSSQYGPCIGISRIKRWQRAQRLGLKPPIEVLAV
LLKEEAQGNAGIQRAHMDELLNSTAVGSVGV
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccacccgcagatcgtctcggcccgccgtgggcgcaggcaagcagtcgacgctc
agcttcaagcacaaagtcaccaaggccatcaagaccggcaaggaaggctacaaatcgcca
tctcgcgcaaaagaatacatccccgcaccctcgcccgaaccagccaccaccgacgagaag
ccagccccctccccctcctcctccgacgacagccgactcaaacagatcgagcagcagcag
ctgaagcagcagcagccgccgacagcggcggcggcagacgaggagaccgatccggaccgc
cgcgccgccgcgcaggtcacggatgcggcgattgagcggtactgggcgggcatcgaggcc
gggcgccgcgcgcgcgcggtgcaccggaagcacgccgagggcctgagcacgggcgagaag
gtgctgcggtactttgacgtgagctcgcagtacgggccctgcatcggtatttccaggatc
aagcggtggcagcgggcgcagaggctcgggctgaagccgccgattgaggtgctggcggtg
ctgttgaaggaggaggcgcaggggaatgcgggcatccagagggcccatatggacgagctt
ctgaactcgactgcggtgggctccgttggggtctga

DBGET integrated database retrieval system