KEGG   Thielavia terrestris: THITE_2089378Help
Entry
THITE_2089378     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
ttt  Thielavia terrestris
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    THITE_2089378
Translation factors [BR:ttt03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    THITE_2089378
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:complement(join(2157696..2158130,2158195..2159737,2159807..2160189,2160450..2160551,2160625..2160699))
Genome map
AA seq 845 aa AA seqDB search
MAGRRGSLEPGRHGFSAVNQVKLQSLAVGYLEQKRESQTSGDGDFQTQVPRHPVTGGKVP
PSKAPRQRNNEDCNPASLVLFAPTSQYRRSSQRVPSMAPSFDRLREEDLDEELDDLDDVD
ISDLREKYEVQLEQGYDTFVVIDGLPKVNEERKPKLIKFLLKKLNTVGRTREDLIYMPMG
DDGNSLQFAFVEYSSPAEAAAAVRQLDYTVLDKSHTMRVNKLTDIDRYGREGRIDEEYTP
PEIEPFQEKEHLRSFMADPSGRGRDQFVMFRGDSVGVFWNNEKDQPENIVDRQHWTETFV
QWSPLGTYLTSVHAQGVLLWGGASWSRLKRFPHPFVNLIAFSPNEKYLVTWSNRPISIPD
SGHPALSLDDDGKNYVIWDIETAKPLRSFAQQDIPGTEEHAGVKKPPKFPWPAFKWSADD
KYVARLNQGTSISVYELPKMNLLDKTAVKIDGVMDFEWAPATPRRDGVKTYEQLFCFWTP
EIGSNPARVALMSIPSKQIVRSLNLFSVTDAKLHWQSDASYICVKVDRHSKSKKSQATTL
EIFRVKEKGVPVEVVDTIKDTVINFAWEPKGDRFVIITTTEPIGPTAVPPKTAVSFFCPE
KTKGNTVGNFKHLRTLEKRNNNAIYWSPKGRFVVIATVHNQQSSDLEFFDLDFEGDKPEA
EKDLTANLQLMNTSEHYGVTDVEWDPSGRYVASWASAWKHSMENGYHLYDFKGELLREEA
IDKFKQWQWRPRPPTLLTREEQKQIRKNLREYSRVFEQEDAERISSADVAVVQHRRRLLE
EFYAWRAVVEEELAEERAALGLPADPVAELLKAKTAEIAPQGEVQEQVIEEIMEEVLEET
EEIVN
NT seq 2538 nt NT seq  +upstreamnt  +downstreamnt
atggcggggaggaggggcagcttggagccaggcaggcacggtttctcagcagtcaaccaa
gtcaagctgcagtcattggcagtcgggtacctggaacaaaagcgggagagtcagacttca
ggagacggagacttccaaactcaggtacctcgacatcctgttactggcggcaaggtgccc
ccctccaaggccccgcggcagcgcaacaacgaggactgcaatcccgcttccctggtatta
ttcgcaccaacctcgcaataccgccgatcttcacagcgtgtgcccagcatggcgccgtca
tttgaccgcttgcgcgaggaagacctcgacgaggagttggacgatctggacgacgtcgac
atttccgacctgcgagaaaaatatgaggtccagctcgagcagggctacgacaccttcgtc
gtcatcgacggccttcccaaggtgaacgaggaaaggaaaccgaagttgatcaagttcctg
ctgaagaagctcaacacggttggccggacccgggaggacctcatctacatgcccatgggc
gacgatgggaattcgctgcaatttgcctttgtcgaatattcttcaccggccgaggctgcc
gccgccgtgcgccagctcgactataccgtgctcgacaagagccacaccatgcgcgtcaac
aagcttaccgacatcgaccggtacggccgggaaggccgcatcgatgaagagtacaccccg
cccgagattgagccgttccaagaaaaggagcacctccggtcgtttatggcggaccccagc
gggcgcggcagagaccagttcgtcatgttccggggggattcggtgggtgtcttctggaac
aatgagaaggaccagccagagaacatcgtcgaccggcaacactggaccgagactttcgtt
cagtggtcgccgctgggcacatacctcacttcggtgcatgcgcaaggcgtgctcctctgg
ggcggcgcctcgtggtcaagactgaaacggttcccccaccccttcgtcaacctcatcgca
ttctcccccaacgagaagtacctcgtcacctggtcgaaccggccgatctcgattcccgac
agcggccacccggccctgtcgctcgacgacgacggcaagaactacgtgatttgggacatt
gagacagccaagccgcttcgctcgtttgcccagcaagatattccaggtactgaggagcac
gccggtgttaagaaaccgcccaagttcccgtggccggcgttcaagtggtctgccgacgac
aagtacgtggcgaggctgaaccagggcacctccatctccgtgtacgagctcccgaagatg
aacctcctggacaagacggcggtcaagatagacggcgtgatggatttcgagtgggcgccc
gctaccccgcgtcgggacggtgtcaagacgtacgagcaactcttctgcttctggacccca
gaaatcggcagcaatcccgcgagagtcgccttgatgagcatcccctccaagcagattgtc
cgctcgctgaatctcttcagcgtcacggacgcgaagctccactggcaatccgatgcctcg
tacatctgcgtcaaggtcgaccggcactccaagtccaagaagtcgcaggcgaccaccctc
gagatcttccgcgtcaaggagaagggcgtgcccgtcgaggtcgtcgacaccatcaaagac
acagtcattaactttgcctgggaacccaagggtgatcgattcgtcatcatcacgaccacg
gagcccatcggtcccaccgccgtgccgccgaagaccgccgtctccttcttctgccctgaa
aagaccaagggcaacactgtcggaaacttcaagcacctgcgcacgctcgagaagaggaac
aacaacgccatctactggtccccgaagggccggttcgtcgtcatcgccaccgtgcacaac
caacagagctccgacctcgagttctttgatctcgacttcgagggcgacaagccggaggcc
gagaaggatctgactgccaacctgcagctgatgaacacgtccgagcactacggcgtgacc
gacgtggagtgggatccctcaggccgctacgtcgcctcctgggcgtcggcgtggaaacac
tctatggaaaacggctaccacctctacgacttcaagggcgagctgctgcgcgaggaggcc
atcgacaagttcaagcagtggcagtggcgcccgcggccgcccacgctgctgacgcgcgag
gagcagaagcagatccgcaagaacctgcgcgagtactcgcgcgtcttcgagcaggaggac
gccgagcgcatcagctccgccgacgtcgccgtcgtccagcaccgccgccgcctgctcgag
gagttctacgcctggcgcgccgtcgtggaggaggagctcgccgaggagcgcgccgccctc
ggcctgcccgccgaccccgtcgccgagctgctcaaggccaagacggccgagatcgcgccc
cagggcgaggtccaggagcaggtcatcgaggagattatggaggaggtcctggaggagacg
gaggagattgtgaactaa

DBGET integrated database retrieval system