KEGG   Thielavia terrestris: THITE_2092104Help
Entry
THITE_2092104     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K00545  
catechol O-methyltransferase [EC:2.1.1.6]
Organism
ttt  Thielavia terrestris
Pathway
Tyrosine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    THITE_2092104
Enzymes [BR:ttt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.6  catechol O-methyltransferase
     THITE_2092104
Exosome [BR:ttt04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   THITE_2092104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5:complement(join(2866570..2866617,2866749..2867492,2867544..2867573))
Genome map
AA seq 273 aa AA seqDB search
MTGERRSEYTRTEGSEVKLLHFIYSRPDLDEIRGNPGKVLDLIEEFEKQYWFPNVGRTKG
EIVIKLIEEHRPRKMIELGGYVGYSAILFGDALRRHGGERYYSLELNPEFAAVANRLIEL
AGLGDFVQTIVGRSDKSLHKLYTSGEISKVELLFIDHYKPAYKTDLQLCEELGLIQPGSV
IAADNVLFPGNPPYLQYVRSTVSEKRQAAQKATGFSKDGFSEKTLSKYMGQDSAPAFEVV
GNPNIVYQSTPIQPEGDPDAIEVTKCVAVEEES
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgacgggagagcgccgatcggagtacacgcgcactgaagggagcgaggtcaaactgctc
cacttcatctactcccgtcccgacctggacgagatccgcggaaatcccggcaaggtcctt
gacctcatcgaggagttcgaaaagcagtactggttccccaacgtcggccggaccaagggc
gaaattgtcatcaagctcatcgaggagcaccggccacgcaagatgatcgaactcggcggc
tacgtcgggtactcggccattctgttcggggacgccctgcggcgccacggcggcgagcgg
tactacagcctcgagctgaacccggagttcgcggcggtggccaacaggctcatcgagctg
gcgggcctgggcgacttcgtgcagacgatcgtaggccgcagcgacaagtcgctgcacaag
ctctacacgagcggcgagatcagcaaggtcgagctgctcttcatcgatcactacaaaccg
gcgtacaagactgacctgcagctgtgcgaggagctggggctgatccagcctgggtccgtc
atcgccgcggacaacgtgctgtttcccggcaacccgccgtatctgcagtacgtccgcagc
accgtctctgagaaacgccaggctgcgcaaaaggcgaccgggttcagcaaggacggcttc
tcggagaagacgctgtccaagtacatgggccaggattccgctcccgctttcgaggtagtg
ggaaatccgaacatcgtttaccagagtactcctatccaaccggagggagatccggatgcg
atcgaagttacaaaatgcgtagcggtggaggaggaatcgtga

DBGET integrated database retrieval system