KEGG   Thielavia terrestris: THITE_2106250Help
Entry
THITE_2106250     CDS       T02228                                 

Definition
hypothetical protein
Organism
ttt  Thielavia terrestris
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(join(463085..463176,463235..463418,463485..464016,464082..464239,464305..464583))
Genome map
AA seq 414 aa AA seqDB search
MADAFAPRSMKRKNVKGLALKAPPPKPPSSVENARPGPAGKGDDNAAQLEIGIEFNLDLR
PEDLEVIRDLGAGNGGTVSKVRHIPTNTVMARKIIHVEAKKEMRKRIVRELQIMHGCHSD
YIVTFYGAFLNENNDVIMCMEYMDVGSLDRISRVFGPVRVDVLGKIAVATLGGLTYLYAK
HHIMHRDIKPSNILVNSRGSIKLCDFGVSGELINSVADTFVGTSTYMAPERIQGERYTVK
SDVWSFGLTIMELAIGKFPFAASEQLSDAESAPAGILDLLQQIVHEPAPKLPKSDAFPQI
LEDMIQKCLYKEPERRPTPQELFDRDLFVQAAKRTPVDLREWACGLMDRDNRKSHLAPQP
SPATQDLLRSSDSPTYGTQQTPTSSYRIDRQAADHANLAAQVDRLYIREWDHEQ
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgcattcgccccgcgctccatgaagcgcaagaacgtcaagggtctcgctttg
aaggctcctcccccgaagccgccgtcgtccgttgagaatgcccgtccgggtcccgctggg
aaaggggatgacaacgctgcgcagctggagattggtatcgagttcaacttggatttgaga
ccggaggatctcgaagtcatcagggatcttggcgctggtaacggcgggacagtcagcaaa
gtcaggcacatcccgacaaacacggtgatggcacgaaagatcatccacgtcgaagccaag
aaggaaatgcgcaagcgtatagtccgcgagctgcagatcatgcacggctgccactccgac
tacattgtcactttctacggcgccttcctcaacgagaacaacgacgtaatcatgtgcatg
gaatacatggatgtcggttcgcttgaccgtatctcccgagtattcggaccggtcagggta
gacgtgctcggcaagatcgctgtggctacgctcggcggactcacctatctctacgcaaag
catcatatcatgcaccgcgacatcaagccgtcaaatatcctggtcaactcgcgaggatcc
atcaagctttgcgattttggtgtctccggggagctgatcaactcggtcgccgatacattc
gtcggcacgtccacgtacatggcgcccgagagaatccagggcgagaggtacacggtcaag
tcggacgtgtggagcttcggtctgactatcatggagttggcaattggcaaatttcccttc
gctgcgagcgagcagctgtccgatgccgaaagcgcgcccgctggcatcctggatttgctg
cagcagatcgtgcatgagccagcccctaagcttcccaagagcgatgcattcccgcagatt
ctcgaagacatgatccagaagtgtctatacaaggaacccgaacgacggccgacgccccaa
gagttattcgaccgagaccttttcgtacaagccgcgaagaggactcctgtcgacttgagg
gagtgggcctgcggtctgatggatagggataaccgcaagtcccatctggcgccccagccc
tcacccgcgactcaagatctcctgcgctcaagcgactctcccacatacggcacccagcaa
acgcctacttcttcctaccgaatcgaccggcaggccgcggaccacgctaacttggctgcg
caagtggaccgtttgtacattcgggagtgggaccacgagcaatga

DBGET integrated database retrieval system