KEGG   Thielavia terrestris: THITE_2106250Help
Entry
THITE_2106250     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K11226  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
ttt  Thielavia terrestris
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    THITE_2106250
Enzymes [BR:ttt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     THITE_2106250
Protein kinases [BR:ttt01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   THITE_2106250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(join(463085..463176,463235..463418,463485..464016,464082..464239,464305..464583))
Genome map
AA seq 414 aa AA seqDB search
MADAFAPRSMKRKNVKGLALKAPPPKPPSSVENARPGPAGKGDDNAAQLEIGIEFNLDLR
PEDLEVIRDLGAGNGGTVSKVRHIPTNTVMARKIIHVEAKKEMRKRIVRELQIMHGCHSD
YIVTFYGAFLNENNDVIMCMEYMDVGSLDRISRVFGPVRVDVLGKIAVATLGGLTYLYAK
HHIMHRDIKPSNILVNSRGSIKLCDFGVSGELINSVADTFVGTSTYMAPERIQGERYTVK
SDVWSFGLTIMELAIGKFPFAASEQLSDAESAPAGILDLLQQIVHEPAPKLPKSDAFPQI
LEDMIQKCLYKEPERRPTPQELFDRDLFVQAAKRTPVDLREWACGLMDRDNRKSHLAPQP
SPATQDLLRSSDSPTYGTQQTPTSSYRIDRQAADHANLAAQVDRLYIREWDHEQ
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggccgacgcattcgccccgcgctccatgaagcgcaagaacgtcaagggtctcgctttg
aaggctcctcccccgaagccgccgtcgtccgttgagaatgcccgtccgggtcccgctggg
aaaggggatgacaacgctgcgcagctggagattggtatcgagttcaacttggatttgaga
ccggaggatctcgaagtcatcagggatcttggcgctggtaacggcgggacagtcagcaaa
gtcaggcacatcccgacaaacacggtgatggcacgaaagatcatccacgtcgaagccaag
aaggaaatgcgcaagcgtatagtccgcgagctgcagatcatgcacggctgccactccgac
tacattgtcactttctacggcgccttcctcaacgagaacaacgacgtaatcatgtgcatg
gaatacatggatgtcggttcgcttgaccgtatctcccgagtattcggaccggtcagggta
gacgtgctcggcaagatcgctgtggctacgctcggcggactcacctatctctacgcaaag
catcatatcatgcaccgcgacatcaagccgtcaaatatcctggtcaactcgcgaggatcc
atcaagctttgcgattttggtgtctccggggagctgatcaactcggtcgccgatacattc
gtcggcacgtccacgtacatggcgcccgagagaatccagggcgagaggtacacggtcaag
tcggacgtgtggagcttcggtctgactatcatggagttggcaattggcaaatttcccttc
gctgcgagcgagcagctgtccgatgccgaaagcgcgcccgctggcatcctggatttgctg
cagcagatcgtgcatgagccagcccctaagcttcccaagagcgatgcattcccgcagatt
ctcgaagacatgatccagaagtgtctatacaaggaacccgaacgacggccgacgccccaa
gagttattcgaccgagaccttttcgtacaagccgcgaagaggactcctgtcgacttgagg
gagtgggcctgcggtctgatggatagggataaccgcaagtcccatctggcgccccagccc
tcacccgcgactcaagatctcctgcgctcaagcgactctcccacatacggcacccagcaa
acgcctacttcttcctaccgaatcgaccggcaggccgcggaccacgctaacttggctgcg
caagtggaccgtttgtacattcgggagtgggaccacgagcaatga

DBGET integrated database retrieval system