KEGG   Thielavia terrestris: THITE_2106343Help
Entry
THITE_2106343     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
ttt  Thielavia terrestris
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(join(673448..674734,674809..677881,678012..678070))
Genome map
AA seq 1472 aa AA seqDB search
MSRERQIPAGPRRENQSPTRRTVSGSPTKLGPGRWPTTDAPMLSASSSNNHSLFSFGGKH
GLPDDVTDTATSFDFLPSVSFDDLQSSLESASADFKLTQFPSPTGQGPILADRPLAAGNT
MVERPDITRHTVASHAAAQQPPVTRSRTGSILRRPSTSSRHASISSTAPSNPGVQNAPTA
PAAMRSRRQSHYPPVSNANIVKPPRKSTGDVAIGGEFEPRKRRPSVASLSDRNGLESTTR
SSIDGGSRLAGDVLRAHTNSRTAKARSVQPPPRASQAMLSADTNTMSLDPGHTSTALPRS
PRTSAKGPNPTGKRISVMPGAPQLPHATGLGARTISPTDTRRMQRLSMHHTQGQPTAPVL
PNPPQLTADGRSSSRSPSILPRKISTPSSSRTTPDPNRKSYSSGLSITSNASVSTTVRTS
TASVQQRNSQAASSRLPAPKVLGLHNSVSHDEEEDVPPVPAIPKAYESPKETFITEAGPL
DKRKSNLAYDASSIHSNSTGSVSGGVNEAPHAKTHRRASQRKSVHTSKLDMESKAVVSQT
KKTLEPLRLPPITLGPLSTPTAARIAALQEQGSSDRNLSPPPARQIPKTPTTPMTASKSA
FFRTRPEERTDVQHLRSSSSVYRFRRESPPPPEPTSSSESVTAVNNGNQRSGPSPFLSSS
LPKGGHMEAAFLKRSKTGGDFTLPLDNTAAAESTTHLSKPSGPRAEKTATARPAKSPPPL
SSPDEPPTPSSMSSLRRKLSLSWKRSASKSGSSGQLQVEKSEHGTVKHDSMPPPRIPASV
TLNSVNTGKPPSPTPSAKSSGAGTYLESRRRKSSASSLNAIIAQEQRGRSDGLGTAKKES
TLDTVAERTTLAHNSSVVQKILKPRQSSAALRHHDVWTAELDKDDMIAEEEMMKLGLRRK
DTELAARTLDALRKRATPKERVSPQEAIRIAVLNIYERGEIVDYKDVYFCGTQNAAKVVG
DPQSDSPNFGYDDERGDYSIVPGDHLAYRYEIIDVLGKGSFGQVVRCIDHKTGALVAVKI
IRNKKRFHQQALVEVNILQKLREWDPHNKHSMVNFTHSFYFRGHLCISTELLDMNLYEFI
KSNAFRGFSLKMIRRFTKQMLSALNLLKQHKVIHCDLKPENILLRHPLHTEIKVIDFGSS
CFENEKVYTYIQSRFYRSPEVILGMSYGMPIDMWSLGCILAELYTGVPIFPGENEQEQLA
CIMEVFGPPEKHLIEKSTRKKLFFDSMGKPRLTVSSKGRRRRPSSKTLQQVLKCDDEAFL
DFIARCLRWDPDRRMKPEEAIRHEFITGQKSSVPVPRSAIRDSSPSKRVASLNAGPRPLP
EPPAAAKSNPSSLRSRDAAAGFNAHHHNSPLKPGMAPSSTASTTRRTSGVVASSSSTTAS
ASTAAPASTIPGLKRTSTGTGAGAGTASHSNGASAAPSGPLSGSHSNSSLPRASIRSVSG
SFAGVGGGAGAGGGVRQDLATAGASAAMGRRV
NT seq 4419 nt NT seq  +upstreamnt  +downstreamnt
atgagcagagagcgccagattcccgctggccccagacgggaaaaccagtcgcccaccagg
aggacggtctccggcagtcccaccaagctcggccccggccgctggcccaccaccgacgcc
ccgatgctcagtgcttcgtcctcaaacaaccactctctcttctcctttggcggcaaacat
ggcctgcccgacgacgtgaccgacaccgccacctcgttcgacttcctcccctccgtcagt
ttcgacgatctgcagagcagcctggaatccgcctcggcagacttcaagctgacccagttc
ccgtcgcccacgggccaaggacccatcctggcggaccgccccctggcagcaggaaacacg
atggtggaacgtcccgacataacgcgacacactgtcgccagccatgctgccgcacagcag
ccgcccgtcacgcgctcgcgaaccggctcgatcctccggagacccagcacgtccagcaga
catgctagcatatcgtcgaccgcgccaagcaaccctggcgtgcagaatgctcccacggcc
ccggcagccatgcgctcgcgccggcagagccactaccccccggtctccaatgccaacatc
gtcaaaccgccaagaaagtcgaccggggatgttgccattggaggcgagtttgagcctcgc
aagcggagaccaagcgtggcttccttgtcggacaggaatgggctggaatcaacaacgcgg
tcctctatcgatggtggatcacgtctggcgggcgatgtcctgcgggctcacacgaattca
cgaaccgcaaaggcgagatccgtgcaaccgccgccgagagccagccaggccatgctgtcc
gcggacacgaacaccatgtcgctggaccccggccacacatcgacggcgcttcctcgctcg
ccaaggacctccgccaaaggcccgaatcccacggggaagcgcatatccgtgatgcccgga
gcaccccaactgccgcatgcgacaggcctcggcgcccggacgattagccctaccgacacg
cggcggatgcaacgtctgtcgatgcaccacacccaaggccagcccaccgccccggtgctc
ccgaacccgccgcaactgactgccgacggccgctcctcgtctcgctccccttccatactt
ccgcgcaagatctcgacgccctcgtcctctcggacaacccccgatccaaatagaaaatca
tacagttctggtctttccatcacctccaatgccagcgtcagcactactgtgcgaacatcc
actgcgtcggtccagcagcgcaactcgcaagctgctagctctcggctacctgccccaaaa
gttcttggtcttcacaactcggttagccacgacgaggaggaggatgttcccccggtccca
gcgatccccaaggcgtacgagtcgccaaaggagacgtttatcaccgaggccgggcctctc
gacaagaggaaatcaaatctggcttatgacgcgagcagcatccacagcaactcgacaggg
agtgtgtctggcggagtgaatgaggcaccgcatgccaagacgcaccgcagggcgagccag
cgcaagtcggtccatacctccaagctggacatggaatcgaaggccgtggtttcgcagacc
aagaagacgctggagcctttgaggctgccacccatcacactgggcccgttgagcactccg
accgctgccaggatcgccgcgcttcaagagcagggttcgtcggacaggaatctctccccg
ccgccagcgaggcaaatcccaaagacgccaacgacacccatgacggcgtccaagagcgca
ttcttcaggacccggcccgaggaaaggaccgacgtgcaacaccttaggagtagcagctcg
gtgtatcgattcagaagggagagtccccctccgccagagccgacgagctcctccgagtct
gttacggctgtaaacaacgggaatcaaagatccggtccgtcgcccttcttgagctcgtcg
ttgcccaaaggaggccatatggaagctgcattcctgaagaggtccaagacgggcggcgac
ttcactctcccgctagacaacacggccgcggcggagtcgacaacccatctcagcaaaccc
tcgggtccccgagcggaaaagactgccacggcaagaccagccaaatctccgcctccgctg
tccagccctgatgagcccccgaccccttcgtctatgagctcgctaaggaggaagctgagc
ttgtcatggaagcggagtgcctccaagagtggcagcagcggccagcttcaggtcgaaaag
agcgagcacggcaccgtgaagcatgattccatgcctccgccacggatccccgcctcggta
actttgaacagcgtcaatacgggcaaacccccgagcccgacgccgtcagccaagtctagc
ggggctggaacctacttggaatcgaggaggcggaagagctcggcctcgagccttaacgcc
attatcgcccaggagcagcgcggccgcagcgatgggttgggcacggcgaagaaggagtca
acactcgacacagtcgccgaacgcaccactcttgctcacaattcatctgtggtgcaaaag
atcctgaagcccagacagtcgtctgccgccctgcgacaccatgatgtctggacggcagag
ctcgacaaggatgacatgatcgccgaggaggagatgatgaagctggggttgcggcgcaag
gacacggagctggccgctcggacgctggatgcgctgcggaagcgtgccactcccaaggag
cgcgtcagcccccaggaagcgatccgcatcgccgtgctcaacatctacgagcggggcgag
atcgtggactataaggacgtctacttctgcggcacccagaacgccgccaaggtggtcggc
gatccgcagtccgacagtcccaattttggctacgacgacgaacgcggggactactcgatc
gtgcctggcgaccacttggcctaccgctatgagatcattgatgtgcttgggaaggggagc
ttcgggcaggtggtccgctgcattgaccacaagaccggcgcgctcgttgccgtcaagatc
atccgcaacaagaagcggttccaccagcaggcgctcgttgaagtcaacatcctgcagaag
ctccgtgaatgggacccgcacaacaagcacagcatggtcaacttcactcatagcttctac
tttcgcggccacctatgcatctccaccgagctcctggacatgaacctctacgagttcatc
aagtccaatgccttccgcggcttctcgctcaagatgatccgcaggttcaccaagcagatg
ctcagcgcgctcaacctgctgaagcagcacaaggtgatccactgcgatctgaaaccagaa
aacattcttctccggcatcccctacataccgagatcaaggtcatcgattttggttccagc
tgcttcgagaacgagaaagtgtatacgtatatccaatctcggttttatcgctcgccagag
gttatcctgggtatgagttacggcatgccgatcgacatgtggtcgctcggctgcatcctc
gccgagctgtacacgggcgtgcccatcttcccgggcgagaacgagcaggagcagctggcc
tgcatcatggaggtgtttgggccgccggagaagcaccttatcgagaagtccacgcgaaag
aagctcttcttcgacagcatgggcaagccgcgcctcaccgtctcgtccaagggccgccgc
cgccgtccgtcctccaagacgctgcagcaggtcctcaagtgcgacgacgaggccttcctg
gacttcatcgcccgctgcctccgctgggaccccgaccgccgcatgaagcccgaggaagcc
atccggcacgagttcatcacgggccagaagagctcggtccccgtcccgcgctccgccatc
cgcgactcctccccgagcaagcgcgtggccagcctgaacgccgggccccggcccctgccc
gaaccgcccgcagcggccaagagcaacccctcgtcgctgcggtcacgcgacgccgccgcc
ggatttaacgcccaccaccacaactcgcccctaaagccgggcatggccccgtcctccacc
gcctccaccacccgccgaacgtcgggcgtcgtcgcctcctcctcctccaccaccgcttcc
gcctccaccgcagcgcccgcgtcgaccatccccggtctcaagcgcaccagcaccggcacc
ggcgccggcgccggcaccgcctcgcattccaacggcgcgtcggccgccccgtcgggcccg
ctctccggcagccatagcaacagcagcctgccgcgggcgtcgatccgcagcgtgagcggg
agcttcgcgggtgtgggtggcggggcaggtgctggtggcggcgtgaggcaggacctggct
actgccggggcgagtgccgcgatggggaggcgggtgtag

DBGET integrated database retrieval system