KEGG   Thielavia terrestris: THITE_2106520Help
Entry
THITE_2106520     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ttt  Thielavia terrestris
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    THITE_2106520
Enzymes [BR:ttt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     THITE_2106520
Exosome [BR:ttt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   THITE_2106520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(join(1005328..1006236,1006292..1006531))
Genome map
AA seq 382 aa AA seqDB search
MSFSSLVQDLSLRDSGAPRRRAEASVSTIDDRASHISMAKSYTSTAATSVSISGDISSQL
HAGYSHPLARTWQAERQLTKSMLIYPLFISDQDDEEVLIPSLPNQYRRGINRLIPFLEPL
VHKGLRSVILFGVPMRPGTKDALGTAADDPEGPVIRSIQLLRRRFPHLYIVCDVCLCEYT
SHGHCGILREDGSLNNQLSVDRISDVAVAYARAGAHCVAPSDMNDGRIRAIKLKLIEEGI
VHSVTLMSYAAKFSGCLYGPFRDAAGSAPSFGDRRCYQLPPGGRGLARRAIVRDINEGAD
IIMVKPAGQYLDIISDAKELGKDLPIAAYQVSGEFAMIHAAAKAGVFDLKTMVFESTESI
LRAGASIVISYFVPELLDWLSN
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttctcgagcctcgttcaggacttgtcgcttcgcgactctggcgcacctaggaga
cgcgccgaggcctccgtttccacaatcgacgaccgagcctcgcacatttctatggccaaa
tcgtacacgagcactgccgcgacaagcgtgagcatctcgggggacatctcgagccagctc
catgccggctactcccacccgctggcgagaacatggcaagccgagcggcagctcaccaag
tcgatgctcatctatcccctgttcatctcggaccaggacgacgaggaagtcctcatcccc
tcgctgccgaaccagtaccgtcgcgggatcaaccgattgattcccttcctcgagccgctt
gttcataagggcctgcgttccgtcatccttttcggcgtgcccatgaggccgggcaccaaa
gacgctctgggaacggcagccgacgacccggagggtcccgtcatccgcagcattcagctc
ctgcgacgaagattcccccacctctacatcgtgtgcgacgtctgtctgtgcgagtatacc
tcccacggccattgcggtattcttcgggaggacggcagcctgaacaaccaactctcggtc
gaccgcatctcggatgtcgccgtcgcttacgcccgtgcaggcgcccactgcgtggcgccg
tccgacatgaacgacggccggatccgtgccatcaagctcaagttgatcgaggagggcatc
gtgcacagtgttactctgatgtcgtatgccgccaagttctcgggctgcctgtacggaccg
ttccgcgacgctgccggctcggctccgtcgtttggcgaccgcagatgctaccagttgccc
cccggtgggcgcggtctcgcgcgccgcgccatcgtccgcgacatcaacgagggcgccgac
atcatcatggtcaagccggccggccagtacttggacatcatcagcgatgcgaaagaactg
ggcaaggacctgccgatcgcggcgtaccaggtcagcggtgagttcgccatgatccacgcc
gcggccaaggctggcgttttcgacctcaagaccatggtgttcgagagcaccgagagcatt
ctcagagctggtgcaagcatcgtcatcagctacttcgttccagagctcctggactggctg
tccaactga

DBGET integrated database retrieval system