KEGG   Thielavia terrestris: THITE_2106937Help
Entry
THITE_2106937     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
ttt  Thielavia terrestris
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    THITE_2106937
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    THITE_2106937
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     THITE_2106937
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1626030..1629362
Genome map
AA seq 1110 aa AA seqDB search
MTSDSLRTRRARPSQVKTDLGPDTNVVVVSSSLMRTSSISPASQHGSPAQSVETVGTALT
SGSSLQNSPEPLEPLPEKALDEIDPWAPTFQLPEPVGGKPLVDPVAPQLSHKTSTSSLYQ
ATVKSPGTTSTGEAVKMSLVRRASNSVRSKAAVLMNRRPSSTNSRSRDASVGPGVVRRRG
SMSNPSVPLENVSPFESESEVDTGAPAEERCGSDGSLAESGPQGSATPSDGFGLIPLALR
QGMTLTKVTKKKSTKRIMVYLDPDSAKIWWDRNRSSKSVYIDDIKEIRTAEDIRQYRLDA
ALPEAVEKRFFSLIYTLPNKPGTKTLHLIADTDKSFQQWVQALETITKHRQDFATSLMSF
HDKAVRAYWGMEMDKQLGKLRSPEDEHIDFAGVERVCRSLHIHVSTEQLRRTFDLAKGRR
ASSDDLPSSQSRSGRLNFDEFLEFVRLMKTREDIRRVYQAHTSDAEGGMTKDEFFQFLRQ
VQAEDVDDDLAYWETVFARFSRKGRPRDVEKQSLAGEESSTMSEAAFSSFLTSTWNDVIP
KEPQNYVLDRPMNEYYISSSHNTYLLGRQVASASTHEGYISALMRGCRCVEIDCWEGQDG
QPVVMHGHSLTTRISFLEVIRTINKYAFVKSHFPLWISLEVRCPPAVQITMAKIMIDVFG
DKLVRAPLDPSSDRLPSPSDLMDRILIKVKKSDESIRTVERTGRRRGNSLPSPYQRALAM
EHVPVPSPPSPLLSPALTSRSNRQINTITEGLVHEPVSSSSPSECDSEGEASVVKKATSK
IHPALGDLGVYCMGIHFDGFDSPDAKKFNHIFSFKEKTFAEKSQPPAGKSALYRHNMRYM
MRVYPNGGRINSSNFDPLIYWKRGVQMAALNWQTFDTGMQLNQAMFDGGTAQSGYVLKPL
EGRQIQVMPNLSPDECIGKRPRKKVAFEIVVISAQQLMRPWNLGEKRTMDPYVEVEVLMA
DDKRNKADAAAYAAAQQMQLKQRTKVVRDNGFNPEFNQTFSFDVTTKYPDLIFVRWSVKL
SDKSSPLATFTAKLSNLKQGYRTIPLLNHNGERFLFSTLFCKIRRGPVTDIMVAYQEDAP
KNGNKLKNIGRNVFSQTNTSPKSSMESGRT
NT seq 3333 nt NT seq  +upstreamnt  +downstreamnt
atgacttccgactccctccggacgcgtcgagcgcgtcccagccaagtcaaaactgacctg
ggtcccgacaccaacgttgtcgttgtttccagctcccttatgaggacctcgtccatctcg
cccgcctcccagcatggctcacccgcccagtcggtcgagaccgttgggacggcgctgacc
tcgggaagctcattacaaaactcccccgagccgctcgagcctctcccggagaaggctctc
gacgagattgacccgtgggctccgaccttccaacttccagaacctgtcggcggcaagcca
ctggttgacccagttgcgcctcagctgtcgcacaagaccagcacatcctcgctgtaccag
gccaccgtcaaatcccctggaacgacgtccacgggcgaggctgtgaagatgagcctcgtc
cgccgggcgtcgaattccgtccgcagcaaagccgccgtgctcatgaacagacggccgtcg
tcaaccaactcgaggagccgggatgcgagcgtgggccccggcgtggtgcgccgcagggga
agcatgagcaacccgagcgtacccttggagaacgtcagccccttcgaaagcgaatctgag
gtcgacaccggtgctccggctgaggaacggtgtggcagcgatggatccctcgccgagtct
ggtccgcagggttccgcgactccttccgacggcttcgggttgatcccgctcgcccttcgc
cagggcatgaccctgaccaaagtcaccaagaaaaagagcaccaagagaatcatggtgtac
ctcgatcccgattcggctaagatctggtgggacaggaatcggtcctcaaaatcggtgtac
atcgacgacatcaaggagatacgcacagcagaagacatacggcagtaccggctcgacgcg
gcgctgcccgaagccgtggagaagcgtttcttttcgctgatctatacgcttcccaacaag
ccgggcaccaagacgttgcacctcatcgcggacacggacaagtcgttccagcagtgggtc
caggccctcgagaccatcaccaagcaccgacaggacttcgcgacgagtctgatgtcgttc
catgacaaagccgtccgtgcgtattgggggatggagatggacaagcagctggggaagttg
cgttcccccgaggacgagcatatcgactttgccggcgtcgagcgcgtatgtcggagcctg
cacatccacgtctccaccgagcagctgcgcaggacatttgacctggccaagggcagacga
gccagctcggacgacctgccgtccagccagagccgcagtggtcgtctcaatttcgacgag
ttccttgaatttgtgcggctcatgaagacgcgcgaggacatccggcgcgtgtatcaagcg
cacactagcgatgccgaaggtggaatgaccaaggatgagtttttccaattcttgcgccag
gtgcaggccgaagacgtcgacgacgacttggcctactgggagaccgtctttgcgcgcttc
tcccgcaagggcaggccgagggacgtcgagaagcagtcccttgccggcgaggagagctcg
accatgtccgaggctgccttctccagctttctcacgtctacatggaacgacgtcattcct
aaggagccgcagaactacgttctcgaccggccgatgaacgagtactacatttcgagctcg
cacaacacctacttgctcggccggcaggttgccagcgcctcgactcatgagggctatata
tcggcgctcatgcggggctgccgctgtgtcgaaatagactgctgggagggccaagacggt
caaccggttgtgatgcacggccactcgctgacgacccgcatctcattcctcgaggtcatc
agaaccatcaacaagtacgccttcgtcaagtcgcacttcccgttgtggatctcactcgag
gtgcgctgcccgccggcggtgcagatcacgatggcgaagatcatgatcgacgtctttggc
gacaagctggtccgcgcgcccctcgacccctcctcggaccgcctgccctctccatcggac
ctgatggaccgcattctcatcaaagtgaagaagtcggacgagtctatcaggaccgtcgag
cggaccggacggcgacgcggcaacagcctgccgtcgccttaccaacgcgcgctagcaatg
gaacacgtgcccgttccctcgccgccgagccctcttctgagcccggcactgacctctcgg
tctaaccgacagatcaacaccatcaccgaaggtttggtgcacgagccagtcagcagcagc
agccctagtgagtgcgacagcgaaggcgaagcgagcgtggtgaagaaggccaccagcaag
atccaccctgccttgggcgatctgggcgtgtactgcatgggtattcactttgacggattc
gacagccccgacgccaagaagttcaaccacatcttctcattcaaagaaaagacgtttgcc
gagaagagccagccgccggcgggcaagagcgctctgtaccgccacaacatgcggtacatg
atgcgcgtctatcccaacggtgggcgcatcaactcgagcaatttcgatcccctcatctat
tggaagcgcggagtgcaaatggccgccctcaactggcagacattcgacaccggcatgcag
ctgaaccaagccatgtttgacggcggcactgctcagtcgggttacgtgctcaaaccgctc
gaggggcggcagatccaggtcatgcctaatttatcgcccgacgagtgtattggcaagcgg
ccgcggaagaaggttgcgttcgagatcgtcgtcatctctgcgcagcagctaatgcggcct
tggaacctgggcgagaagcgcaccatggatccttacgtcgaggtcgaggtgctgatggca
gacgacaagcggaacaaagcggatgcggctgcgtacgctgcggcgcaacagatgcagctc
aagcagcgcaccaaggtcgtccgcgacaatggtttcaaccccgagttcaaccagaccttc
tcgttcgacgtcaccacaaagtatcccgatctcatctttgtgcgatggagcgtcaagctc
agcgacaaatcgtcgcctctcgccacgttcactgccaagctcagcaacttgaagcagggc
taccgcacgatcccgttgctcaaccacaacggcgaacgcttcctgttttcgaccctcttt
tgcaagatccgaagagggccggtaaccgacatcatggtcgcctaccaagaggatgctccg
aaaaacggcaacaaactcaagaacatcggaaggaatgtctttagccagacgaacaccagc
cccaagtccagcatggaaagcggtcggacatag

DBGET integrated database retrieval system