KEGG   Thielavia terrestris: THITE_2107066Help
Entry
THITE_2107066     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
ttt  Thielavia terrestris
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    THITE_2107066
Enzymes [BR:ttt01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     THITE_2107066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(1795784..1796297,1796356..1796990)
Genome map
AA seq 382 aa AA seqDB search
MVLIKSFVLASLAAAAAAKSAVLDLIPDNFDKVVLKSGKPTLVEFFAPWCGHCKNLAPIY
EELALAFEHAKDKVQIAKVDADAERDLGKRFGVQGFPTLKFFDGKSDKPTEYNGGRDLES
LSNFITEKTGVRARKKVAKPSSVVMLTDSTFKQHIGGDKNVLVAFTAPWCGHCKNLAPTW
EKLAENFANEPNVLVAKVDADAETGKATAAEYGVKGYPTIKFFPAGSTTPEDYSGARSEE
AFVTFLNEKAGTHRAVGGGLDAVAGTIESLDAVVAKLVGGTALSEAAAEAKKTAESLTDK
AQAKHAEYYLRVFEKLGKSEEYAAKELARLEGIIKKGGLAPTKLDELTSKTNILRKFVEK
PTESEDKEEKEEKEEKAAKEEL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggtgctcatcaagagcttcgtgctcgccagcctcgcagctgcggctgccgccaagtcg
gctgtcctcgacctcatcccggataacttcgacaaggtggtccttaaatccggcaagccg
acgctggtcgaattcttcgcgccgtggtgcggccactgcaagaacctcgcgcccatctac
gaggagctcgcgcttgccttcgagcatgccaaagacaaagtacagatcgccaaggtcgac
gccgatgccgagcgggacttgggcaagcgcttcggcgtgcagggcttcccgaccctgaag
ttcttcgacggcaagagcgacaagcctaccgagtacaacgggggtcgggaccttgagagc
ttgtccaacttcatcaccgagaagactggcgtgcgggcgaggaagaaggtggcgaagccc
agcagcgtggtcatgcttacggactcgacgttcaagcagcacattggcggggacaagaac
gtcctggtggcctttaccgccccgtggtgcggccactgcaagaacctcgcgcccacctgg
gaaaagctcgccgagaactttgccaacgagcccaacgtcctggtcgcgaaggttgacgcc
gatgccgagacgggcaaggccaccgctgccgagtacggcgtgaaggggtacccgaccatc
aagttcttcccggcaggcagcaccacgcccgaggattacagcggcgcgcggtccgaggag
gcgtttgtcaccttcctgaacgagaaagcgggcacgcaccgcgcggtcggcggcggcctc
gacgcggtggccggcaccatcgagtcgctcgacgccgtcgtcgcgaagctcgtcggcggc
actgcgctaagcgaggcggcggctgaggcgaagaagactgccgagagcctcacggacaag
gcgcaggccaagcatgccgagtactacctccgggtctttgagaagctgggcaagagcgag
gagtatgcggccaaggagctcgcccgtctcgagggcatcatcaagaagggcggcttggcg
cccaccaagctggacgagctcaccagcaagaccaacatcctgcgcaagttcgtcgagaag
ccgacggagagcgaggacaaggaggagaaggaggagaaggaggagaaggcggcgaaggag
gagctttaa

DBGET integrated database retrieval system