KEGG   Thielavia terrestris: THITE_2107141Help
Entry
THITE_2107141     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K03259  translation initiation factor 4E
Organism
ttt  Thielavia terrestris
Pathway
ttt03013  RNA transport
Module
ttt_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    THITE_2107141
Messenger RNA biogenesis [BR:ttt03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     THITE_2107141
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     THITE_2107141
Translation factors [BR:ttt03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    THITE_2107141
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 11515565
NCBI-ProteinID: XP_003649023
JGI: Thite2_2107141
UniProt: G2QSW2
Position
1:complement(join(1939829..1940054,1940129..1940966,1941042..1941066))
Genome map
AA seq 362 aa AA seqDB search
MDNLWSRRASSSKLSLSTSSTGQDSPSGRNSSFKRFGGDSSALGKSSFGAITPGSGLASP
IGGASSAFGLGSGAFASFGSAKTPKSPANPFDSAVGAAVKTPTAEKSAKDGAPGDKAISK
PASTASLKDEGKAAAQPTAGPAAPSAHPLRNSWVFWFRPPISKANGFIEYEKTLHRIATV
ETVEHFFSVYKHLKRPSALPLVSDYHLFKKGIRPIWEDEENKNGGKWVVRLRKGVADRYW
EDLLLAIIGDQFCEASDEVCGAVLSVRNGEDILSIWARESGQRVLKIRETMRRILSFPPD
TKLEWKSHDSSIQQRNAIEESRREKANNHHHGDKRSSNKQQQQQHHHQNQQQGDDQKNPS
SS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggataatctatggagtcgccgtgccagctcgagcaagctctctctttcaacatcaagt
accggacaggacagcccctcggggcgcaactcttccttcaagcgattcggcggtgacagc
tcggcgcttggcaagagctcgttcggcgccataacaccaggcagcggcctggcgtctccg
atcggcggggcgtccagcgccttcggcctgggctcgggcgcatttgcgtcgttcggctcg
gccaagacgcccaagtcgccggcgaacccgtttgactcggccgtcggcgctgccgtcaaa
accccgacggcggagaaatccgcaaaagacggggccccaggagacaaggcgataagcaag
ccggcttccaccgcttcgctgaaggacgagggaaaggcggctgcccagccgacggccgga
ccggcggcaccatcagcccacccgctgcgcaacagctgggtcttttggttccgcccgccc
atttccaaggcgaacggatttatcgagtacgagaagacgctccaccggatcgccactgtc
gagacggttgaacacttcttttcggtgtacaaacacctcaagcggccgtcggcgctgccg
ctggtgtcggactaccatctcttcaagaaggggatccggccaatatgggaggatgaggag
aacaagaacggcgggaagtgggtggtgcgtctgagaaagggcgtcgccgaccgttactgg
gaggacctgctgcttgccatcatcggcgaccagttctgcgaggccagtgacgaggtgtgt
ggggccgtgctaagcgtgcgcaacggcgaggacatcctcagcatctgggctcgggagagc
gggcagcgggtcctcaagatccgtgagacaatgcgacggatcctgtccttcccgccggac
acgaaactcgagtggaagagccacgactcgagcattcagcagcgcaacgccattgaggag
tcacggcgagagaaggcgaacaatcaccaccacggcgacaagcggtcgtcgaacaagcag
cagcagcagcagcatcaccaccaaaaccaacagcaaggtgatgaccaaaagaaccccagc
agctcataa

DBGET integrated database retrieval system