KEGG   Thielavia terrestris: THITE_2107141Help
Entry
THITE_2107141     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
ttt  Thielavia terrestris
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:ttt03013]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(join(1939829..1940054,1940129..1940966,1941042..1941066))
Genome map
AA seq 362 aa AA seqDB search
MDNLWSRRASSSKLSLSTSSTGQDSPSGRNSSFKRFGGDSSALGKSSFGAITPGSGLASP
IGGASSAFGLGSGAFASFGSAKTPKSPANPFDSAVGAAVKTPTAEKSAKDGAPGDKAISK
PASTASLKDEGKAAAQPTAGPAAPSAHPLRNSWVFWFRPPISKANGFIEYEKTLHRIATV
ETVEHFFSVYKHLKRPSALPLVSDYHLFKKGIRPIWEDEENKNGGKWVVRLRKGVADRYW
EDLLLAIIGDQFCEASDEVCGAVLSVRNGEDILSIWARESGQRVLKIRETMRRILSFPPD
TKLEWKSHDSSIQQRNAIEESRREKANNHHHGDKRSSNKQQQQQHHHQNQQQGDDQKNPS
SS
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggataatctatggagtcgccgtgccagctcgagcaagctctctctttcaacatcaagt
accggacaggacagcccctcggggcgcaactcttccttcaagcgattcggcggtgacagc
tcggcgcttggcaagagctcgttcggcgccataacaccaggcagcggcctggcgtctccg
atcggcggggcgtccagcgccttcggcctgggctcgggcgcatttgcgtcgttcggctcg
gccaagacgcccaagtcgccggcgaacccgtttgactcggccgtcggcgctgccgtcaaa
accccgacggcggagaaatccgcaaaagacggggccccaggagacaaggcgataagcaag
ccggcttccaccgcttcgctgaaggacgagggaaaggcggctgcccagccgacggccgga
ccggcggcaccatcagcccacccgctgcgcaacagctgggtcttttggttccgcccgccc
atttccaaggcgaacggatttatcgagtacgagaagacgctccaccggatcgccactgtc
gagacggttgaacacttcttttcggtgtacaaacacctcaagcggccgtcggcgctgccg
ctggtgtcggactaccatctcttcaagaaggggatccggccaatatgggaggatgaggag
aacaagaacggcgggaagtgggtggtgcgtctgagaaagggcgtcgccgaccgttactgg
gaggacctgctgcttgccatcatcggcgaccagttctgcgaggccagtgacgaggtgtgt
ggggccgtgctaagcgtgcgcaacggcgaggacatcctcagcatctgggctcgggagagc
gggcagcgggtcctcaagatccgtgagacaatgcgacggatcctgtccttcccgccggac
acgaaactcgagtggaagagccacgactcgagcattcagcagcgcaacgccattgaggag
tcacggcgagagaaggcgaacaatcaccaccacggcgacaagcggtcgtcgaacaagcag
cagcagcagcagcatcaccaccaaaaccaacagcaaggtgatgaccaaaagaaccccagc
agctcataa

DBGET integrated database retrieval system