KEGG   Thielavia terrestris: THITE_2107313Help
Entry
THITE_2107313     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ttt  Thielavia terrestris
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ttt00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:ttt00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(join(2184745..2185205,2185269..2185311))
Genome map
AA seq 167 aa AA seqDB search
MASATTFYDFKPLDKRGNEVPLSDYKGKVVLVVNTASKCGFTPQYAGLEKLYKSVREKHG
DNFVILGFPCNQFGNQEPGSNEEIQQFCQVNYGVTFPIMAKVDVNGDNASPLFQWLKAQQ
PGILGLKRVKWNFEKFLVGKDGTVKGRWASTTKPESLESTILEELAK
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggcctccgcaacaactttctacgatttcaagccgctcgacaagcggggcaacgaagta
cccctgtccgactacaaaggcaaggtcgtcctggtagtcaacacggcctccaagtgcggc
ttcacgccacagtatgccgggctcgagaagctctacaagtcggtgcgcgagaagcacggc
gataactttgtcatcctcggcttcccctgcaaccagttcggcaaccaagagccggggtcc
aacgaggagatccagcaattctgccaggtcaactacggcgtgaccttccccatcatggcc
aaggtcgacgtcaacggcgacaacgccagccccctgttccagtggctcaaggctcagcag
ccgggcatcctcggcctgaagcgggtcaagtggaactttgagaagttcttggtgggcaaa
gacggcacggtcaagggacggtgggcgtcaactaccaagcctgagtcgttggaaagcacc
attctcgaagaactcgcgaagtga

DBGET integrated database retrieval system