KEGG   Thielavia terrestris: THITE_2107582Help
Entry
THITE_2107582     CDS       T02228                                 

Definition
glycosyltransferase family 3 protein
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
ttt  Thielavia terrestris
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    THITE_2107582
Enzymes [BR:ttt01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     THITE_2107582
Glycosyltransferases [BR:ttt01003]
 Polysaccharide
  Storage polysaccharide
   THITE_2107582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(join(2541085..2541172,2541228..2542786,2542849..2543124,2543206..2543303,2543364..2543448))
Genome map
AA seq 701 aa AA seqDB search
MANEEAEREPRDVKNHVLFEIATEVAHRVGGIYSVIKSKAPVTTAEYGDRYTLIGPLNHH
SAAVEVEAMEPTNPELAATIQSMKDRGIGMLYGRWLIEGAPRVLLFDTKTAYGYMNEWKG
DLWNVASIPSPDNDDETNEAVVFGYLVAWFLGEYVCHEKKRAVIAHFHEWLAGVALPLTR
KRQIDVTTIFTTHATLLGRYLCAGSVDFYNNLQHFDVDAEAGKRGIYHRYCIERAAAHSC
DVFTTVSHITAYESEHLLKRKPDGVLPNGLNVTKFSAVHEFQNLHQQSKEKIHDFVRGHF
YGHYDFDPENTLYFFTAGRYEFRNKGVDMFIESLARLNHRLKSSGSKMTVVAFIIMPAQT
SSLTVEALKGQAVIKSLRDTVDTIERNIGRRIFERSLKWHDGDPMPEEKELISSQDRILL
RRRLFAMKRHGLPPIVTHNMVNDHDDPILNQIRRVQLFNHPSDRVKIVFHPEFLNSANPV
LPLDYDDFVRGTHLGVFASYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEELIENSSDY
GIYIVDRRTKGVDDSVNQLTSYMFDFTQKSRRQRINQRNRTERLSDLLDWKRMGLEYVKA
RQLALRRAYPTSFLGEEEEEDFIPGVEQKISRPFSVPGSPRDRTGMMTPGDFASLQEGRE
GLSTEDYVAWKLPEEEDPDEYPFPLTLRTKASGPGSSLNGK
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgaggaagcagagcgcgagccacgcgacgtcaagaaccacgtgctgtttgag
atcgcgacagaagtcgcgcatcgagtcggcggcatctactccgtcatcaaatccaaggcc
ccggtaaccacagcagaatatggcgaccgctacaccctcattgggcctctcaaccaccac
tccgcggccgtcgaggtcgaggccatggagcccacgaaccccgaacttgccgcaacaatc
cagtccatgaaggaccgcggcatcggtatgctgtatgggcggtggctgattgaaggagct
cctagagtgctcctcttcgacaccaagacggcgtacggttatatgaatgagtggaagggt
gacctgtggaatgttgcctccatcccgtcgcccgataacgacgatgagaccaacgaggcc
gtcgtctttggctatctcgttgcatggttcctcggggagtacgtatgccacgaaaagaag
agggcggtcattgcgcacttccacgaatggctggcaggcgttgcgctgcccttgaccagg
aagcggcagatcgacgtgacgaccattttcacgacccatgcgacattgctcggtcgatac
ttgtgtgccggctccgtcgacttctacaacaacctccagcacttcgacgtggatgctgag
gcgggtaagcgcggtatctaccaccggtactgcatcgaacgagctgcggcgcattcctgt
gacgtgtttaccacggtctcgcacatcacagcctatgagagtgagcatctactcaagcgc
aagcccgacggtgtcctgccgaacggcctcaacgtgaccaagttctcggcggtccacgag
ttccagaacctgcaccagcagtccaaggagaagatccacgactttgtccgaggccatttc
tatggccactacgacttcgatcccgagaacacgctctacttcttcacggcgggtcggtac
gagttcaggaataaaggcgttgacatgtttatcgagtcgctcgcccgcttgaaccatcgg
ctcaagtcgtctgggagcaagatgacggtcgtcgcgttcatcatcatgcccgcccagacc
tcgtcgctgacggtcgaggcactgaaggggcaggccgtgatcaagtctctgagagatacg
gtggacacgatcgagaggaacatcggccgacgcatctttgagcgctccctcaagtggcac
gatggcgatccgatgccggaggagaaggagctgatttccagccaggatcgcatcctgctc
cgcaggcgcctgttcgccatgaagaggcacgggctgcccccaatcgtcacacacaacatg
gtcaacgaccacgacgacccgatcctcaaccagatccgccgggtgcagctcttcaaccat
cccagcgaccgagtcaagattgtgttccaccccgagttcttgaactcggcaaacccggtg
ctgccgctggactacgacgacttcgtgcgaggcacgcatttgggcgtgttcgcatcgtac
tacgaaccatggggttacacgcccgccgagtgcacggtgatgggtgtgcccagcatcacc
accaacctttccggattcggctgctacatggaggagctgattgagaactcgagcgattac
ggcatctacatcgtggatcgccgtaccaagggtgtcgatgactcggtcaatcagctcacg
tcgtacatgttcgacttcacgcagaagagccgccggcagcgcatcaaccagcggaaccgg
actgagcggcttagcgacctgctcgactggaagcggatgggcttggagtatgtcaaggcg
cggcagctcgcgctgagacgggcgtatcccacgtcgttccttggtgaggaggaggaggag
gacttcatcccgggcgtggagcaaaagatctcgcggccattctcggtgcccggctcccca
agggatcgcaccggaatgatgacccctggggattttgccagcctccaggagggtcgtgag
gggctgagcactgaagactacgttgcgtggaaacttccagaggaggaggacccggatgag
tacccgttcccgctcacgttgagaaccaaggcatccggccctggaagctctctgaacggc
aagtga

DBGET integrated database retrieval system