KEGG   Thielavia terrestris: THITE_2107950Help
Entry
THITE_2107950     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
ttt  Thielavia terrestris
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    THITE_2107950
  Replication and repair
   03420 Nucleotide excision repair
    THITE_2107950
Transcription machinery [BR:ttt03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     THITE_2107950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(3473488..3473939,3474015..3474168,3474234..3474632,3474794..3475102)
Genome map
AA seq 437 aa AA seqDB search
MATEDARYRQSSQYQLWSFSPSQLAAMREKTNAAARARIAERLASQPASSRNTSAPTSSA
NTPDPDGASTPALPEFLTPAEEALLVTFYVSELLRAGDHAEMTDEIKATAAAFFRRFYVT
NSIMTYPPTEMLIVALFFACKAEGAFPSITDFGKTFGRENPEEILAGEFLLCQGLRFAID
VKHPFRALRGAVMELSTLPGIEPARLTAAEHRAREILRFSPLMTDAYFHYTPSQIMLAAL
SLADRGLAERLITETFHYVEPPANNSGADTPASSGPDAPAAPKRTAPRSSGGGGSGEDRA
QIIGSHIRDKVLGAIEACRDMLSKELPERREHWTNRAVIKAQITPIRKKLNKCHDPERWN
LVELQRARREQASRRADSEDRDPAEGRGGGKGGTLEDDAAVFGAPLPLSQASRDPKRRKV
GGEAERKGLDDPFGPPL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgaagatgcgcggtaccggcagtcctcgcagtaccagttgtggtccttttcg
ccgtcccagctagcagccatgcgcgagaagacgaatgccgccgctcgagccagaatcgca
gagcgtctcgcctcccagccggcgtcctccagaaacacatccgcgccgacgtcgagcgcg
aacactcccgaccccgacggcgcttccacccccgcgttgcccgagtttctcacgcccgcc
gaagaagccctgctggtgaccttttacgtatccgagctgttgcgcgccggcgaccacgcc
gagatgaccgacgagatcaaggccacggctgccgctttcttcaggcgcttctacgtgacg
aacagcatcatgacgtatccgccgacagagatgttgattgtcgccctgttctttgcttgc
aaggccgagggcgcgtttccaagcataacagactttgggaagaccttcggcagagaaaat
ccggaggagatcttagccggcgagttcctcctttgccaggggctacggttcgccatcgac
gtgaagcatcccttccgggcccttcggggagccgtgatggagttgtccaccttgcccggg
attgagcccgcgcgcctcaccgcagccgagcaccgcgcccgcgagatcctccgcttcagc
ccactcatgaccgacgcctacttccactacacccccagtcagatcatgcttgccgccctc
tccctcgccgaccgcggcctggccgagcgcctcataaccgaaactttccactacgtcgaa
ccgcccgccaacaacagcggcgccgacaccccggcctcctccggccctgacgcgccagct
gccccgaaacgcacagccccccgcagcagcggcggtggcggcagcggcgaggatagagcg
cagatcatcggctcccacatccgcgacaaggtcctcggcgccatagaagcgtgcagggac
atgctctcgaaggaactgcccgagcggagggagcattggacaaatcgagcggtaatcaaa
gcccagatcactccgatccgcaagaaactcaacaagtgccacgacccggagcggtggaac
ctggtcgagctgcagcgcgcgcggcgcgagcaggcgagtcggcgggccgactcggaggac
cgggacccggccgagggcaggggcgggggcaagggcggcacgctggaggacgacgccgcc
gtgtttggcgcgccgctgccgctgtcgcaggcgtcgagggatcccaagaggcggaaggtt
ggcggggaggcggagcggaaggggttggacgatccctttgggccgcctttgtga

DBGET integrated database retrieval system