KEGG   Thielavia terrestris: THITE_2107950Help
Entry
THITE_2107950     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
ttt  Thielavia terrestris
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:ttt03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:ttt03420]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(3473488..3473939,3474015..3474168,3474234..3474632,3474794..3475102)
Genome map
AA seq 437 aa AA seqDB search
MATEDARYRQSSQYQLWSFSPSQLAAMREKTNAAARARIAERLASQPASSRNTSAPTSSA
NTPDPDGASTPALPEFLTPAEEALLVTFYVSELLRAGDHAEMTDEIKATAAAFFRRFYVT
NSIMTYPPTEMLIVALFFACKAEGAFPSITDFGKTFGRENPEEILAGEFLLCQGLRFAID
VKHPFRALRGAVMELSTLPGIEPARLTAAEHRAREILRFSPLMTDAYFHYTPSQIMLAAL
SLADRGLAERLITETFHYVEPPANNSGADTPASSGPDAPAAPKRTAPRSSGGGGSGEDRA
QIIGSHIRDKVLGAIEACRDMLSKELPERREHWTNRAVIKAQITPIRKKLNKCHDPERWN
LVELQRARREQASRRADSEDRDPAEGRGGGKGGTLEDDAAVFGAPLPLSQASRDPKRRKV
GGEAERKGLDDPFGPPL
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgaagatgcgcggtaccggcagtcctcgcagtaccagttgtggtccttttcg
ccgtcccagctagcagccatgcgcgagaagacgaatgccgccgctcgagccagaatcgca
gagcgtctcgcctcccagccggcgtcctccagaaacacatccgcgccgacgtcgagcgcg
aacactcccgaccccgacggcgcttccacccccgcgttgcccgagtttctcacgcccgcc
gaagaagccctgctggtgaccttttacgtatccgagctgttgcgcgccggcgaccacgcc
gagatgaccgacgagatcaaggccacggctgccgctttcttcaggcgcttctacgtgacg
aacagcatcatgacgtatccgccgacagagatgttgattgtcgccctgttctttgcttgc
aaggccgagggcgcgtttccaagcataacagactttgggaagaccttcggcagagaaaat
ccggaggagatcttagccggcgagttcctcctttgccaggggctacggttcgccatcgac
gtgaagcatcccttccgggcccttcggggagccgtgatggagttgtccaccttgcccggg
attgagcccgcgcgcctcaccgcagccgagcaccgcgcccgcgagatcctccgcttcagc
ccactcatgaccgacgcctacttccactacacccccagtcagatcatgcttgccgccctc
tccctcgccgaccgcggcctggccgagcgcctcataaccgaaactttccactacgtcgaa
ccgcccgccaacaacagcggcgccgacaccccggcctcctccggccctgacgcgccagct
gccccgaaacgcacagccccccgcagcagcggcggtggcggcagcggcgaggatagagcg
cagatcatcggctcccacatccgcgacaaggtcctcggcgccatagaagcgtgcagggac
atgctctcgaaggaactgcccgagcggagggagcattggacaaatcgagcggtaatcaaa
gcccagatcactccgatccgcaagaaactcaacaagtgccacgacccggagcggtggaac
ctggtcgagctgcagcgcgcgcggcgcgagcaggcgagtcggcgggccgactcggaggac
cgggacccggccgagggcaggggcgggggcaagggcggcacgctggaggacgacgccgcc
gtgtttggcgcgccgctgccgctgtcgcaggcgtcgagggatcccaagaggcggaaggtt
ggcggggaggcggagcggaaggggttggacgatccctttgggccgcctttgtga

DBGET integrated database retrieval system