KEGG   Thielavia terrestris: THITE_2108019Help
Entry
THITE_2108019     CDS       T02228                                 

Definition
histone acetyltransferase ELP3-like protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
ttt  Thielavia terrestris
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(3662621..3662918,3662986..3664412)
Genome map
AA seq 574 aa AA seqDB search
MATATVTTATTTRKKDASLPPENERFLRCCADIASALIEDHEASKDPSRPRKDINLNTLR
SKFAKKHKINNVPPLTAIIAAVPEHYKKYILPRLIAKPIRTSSGIAVVAVMCKPHRCPHI
AYTGNICVYCPGGPDSDFEYSTQSYTGYEPTSMRAIRARYDPFEQARGRVDQLKALGHSV
DKVEYIIMGGTFMSLPESYRDEFIAQLHNALSGYGTLNVDEAVRAGEQSSIKCVGITIET
RPDYCLQPHLSSMLRYGCTRLEIGVQSLYEDVARDTNRGHTVAAVAETFCLAKDAGFKVV
SHMMPDLPNVGMERDLDQFREYFENPAFRTDGLKIYPTLVIRGTGLYELWRTGRYQNYTP
NGLIDLVARILALVPPWTRIYRVQRDIPMPLVTSGVENGNLRELALARMKDFGTTCRDVR
TREVGVNEVKHRIRPSQIELVRRDYAANGGWETFLAYEDPKQDILVALLRLRKCTQKYTF
REELVGQPTSLVRELHVYGMAVPVHARDPRKFQHQGFGTLLMEEAERIAREEHGSDKISV
ISGVGVRSYYAKLGYWLDGPYMSKWLDGRPGPEE
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggctacggcaacggtaacgacggcgacgacgacccgcaagaaggacgccagcctcccg
cccgagaacgagcgcttcctgcgatgctgcgcggacatcgccagcgctctgatcgaggac
catgaggcgtccaaggaccccagccgtccgcgaaaggacatcaatctcaacacgctgcgc
tccaagttcgccaagaagcacaagatcaacaatgtgccacctttgaccgctatcattgcc
gcggtgccagaacactacaagaagtacattctgccgaggctaatagccaagccaattcgt
acttcgtctggcatcgctgtggtggcggtgatgtgcaagccgcaccgatgtcctcacatc
gcttacaccggcaacatttgcgtctactgccccggcggcccggacagcgacttcgagtac
agcacgcaatcctacacaggctacgaaccaacatccatgcgagccatccgggcgcgctat
gaccccttcgaacaggcccgcgggcgggtcgaccagctcaaggccctgggccactcggtg
gacaaggtcgagtacatcatcatgggcggcaccttcatgtcgctgccggaatcctaccgg
gacgagttcatcgcgcagctgcacaacgcgctgagcgggtacgggacgctgaatgtggac
gaggccgtccgggccggcgagcagagcagcatcaagtgcgtgggcatcacgatcgagacg
cggcccgactactgcctccagccgcacctctcgagcatgctgcggtacgggtgcacgcgc
ctcgagatcggcgtccaatcgctgtatgaggacgtggcgcgcgacaccaaccgcgggcac
accgtcgcggccgtggccgagaccttctgcctcgccaaggacgccggcttcaaggtggtc
agccacatgatgccggacctgcccaacgtcggcatggagcgcgacctggaccagttccgc
gagtacttcgagaacccggccttccggaccgacgggctcaagatctacccgacgctcgtg
atccgcgggacgggcctgtacgagctctggcgcacgggccgctaccagaactacacgccc
aacgggctgatcgacctggtcgcgcgcatcctggcgctcgtgccgccgtggacgcgcatc
taccgcgtgcagcgcgacatcccgatgccgctggtgacgtcgggcgtcgagaacggcaac
ctgcgggagctggcgctggcgcgcatgaaggacttcggcacgacctgccgcgacgtgcgc
acgcgcgaggtcggcgtcaacgaggtcaagcaccgcatccgcccgtcccagatcgagctc
gtccgccgcgactacgcggccaacggcggctgggagaccttcctggcctacgaggacccc
aagcaggatatcctggtcgccctgctgcgcctgcgcaagtgcacgcagaagtacaccttc
cgcgaggagctcgtcggccagcccaccagcctcgtgcgcgagctgcacgtctacggcatg
gccgtgcccgtgcacgcgcgcgacccgcgcaagttccagcaccaggggttcggcaccctg
ctgatggaggaggccgagcgcatcgcccgcgaggagcacggcagcgacaagatcagcgtc
atctcgggcgtcggcgtgcgcagctactacgccaagctgggctactggctcgacgggccg
tacatgagcaagtggctggacgggcggccggggccggaagagtaa

DBGET integrated database retrieval system