KEGG   Thielavia terrestris: THITE_2108379Help
Entry
THITE_2108379     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
ttt  Thielavia terrestris
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(join(4325022..4325134,4325215..4325662,4325755..4326184,4326248..4326405,4326472..4327118,4327183..4328125,4328198..4328660,4328713..4328860,4328933..4329161))
Genome map
AA seq 1192 aa AA seqDB search
MDSVDMDTMGDTARPLHALANLSLQDDNQTPEAASPNSMMVDAPEEHVVEPNGTEPDDVA
IIHPDSMDVDTLLASDYEAMKEHVLQPLAEEPRILDDQVHTWTVEGWRALKQKEHGPIFH
AGGYPWRILLFPFGNNVPDHCSIYLEHGFEANNIPDDWSCCVQFALVLWNKNHPSIFFQQ
TAHHRFTKEESDWGFTRFLESRKMFNTVWENADRPLVDNDCINISAYVRVVEDETGVLWH
NFNNYDSKKETGYVGLKNQGATCYLNSLLQSLYFTNAFRKAIYRIPTQQDESMNNSAYTL
QRLFYQLQTSNTAVGTSELTKSFGWETRHIFEQQDVQELSRKLMERMEEKMKGTEFEKVL
PQMFSGKIKTYISCINVPYESSRVEDFWDVQLNVSGNENLLDSFQDYIQVEKLDGENQYF
AGDQYKLQDANKGVIFMSFPDVLHLQLKRFEYDIQRDVMMKINDRYEFPEEFDASPYLDK
EADRSEPWDYQLHGVLVHSGDQNAGHYYAFLKPNKEGWWYKYDDDKVTKATKREVLEENF
GGPIKLPNGQLRPLGNKKGPLMRPNSAYMLVYIRKSRLDKILCPVTADDTPEHLRRRFEE
EYAAREARRKEREEQHLYLGVKAITEETFRHHGGTDLTDFDATPDQNPAAPRFYRVLRSA
TMQDLVNKIAADLGQDPRLVRLWNMVNRQNKTTRPDQPVMDLRPSVEETYNKAAAHREQA
LRVWVETTEEVDAEGNAVWPTYSGLPNGVVVKNDLILLFLKWFDAEAQALRGIGHLYMSK
EKKVEELIPIIMKKMGWEKLASDEKLQLWEEIKPNMIETLKGKQSLKAAELQDGDIICFQ
RLHERKSRLGLGDKNERQSSEEAAKSLDRAEDAREYYDFLLNKRTVMFLAHPQKCDPKAY
PHFEMVLNARMSYDRLSEKVGEKLGVEPTHLRFYTVNASSNNPRTAVKRSQNQTLGNILV
PAGYGQLSVNQRHDALFFEVLDMSLAELDTKKSIRLTLLSEGITKEEQLDVLVPKNGQVE
DLINCLIKKAKIPSEEEAGRIRIYEISNHRFFRELDRSYPVISVNDYTTVIAERIPSEDA
EVQDPNQFISVFQFHGEPSRAHGIPFRFLLKEGERFADTKKRLEKRTGLKGKSFEKIKFA
VVRRASFSRPQYLTDDDILWDVAANSDDCLGLDHPDRTRSLRNGAGDLFLRG
NT seq 3579 nt NT seq  +upstreamnt  +downstreamnt
atggacagcgtggacatggacaccatgggcgacactgcccggccactccacgccctcgct
aatctgagcctccaggacgacaaccagacccccgaggccgcttcgccaaactccatgatg
gtcgatgctcctgaggagcatgtcgtcgaaccgaatggcactgagccagatgatgttgcc
atcatccaccccgacagcatggacgtcgacacgcttctcgcgagcgattacgaggccatg
aaggagcacgtcctccaacccctggcagaggagcctcggattcttgacgaccaggtacac
acgtggacggtggaagggtggagggcgttaaaacagaaggagcatggcccaatattccac
gccggtggctatccatggcggatcctcctctttccgttcggcaacaacgtccccgaccat
tgctcaatctacctcgaacacggctttgaggcgaacaacatccccgatgactggagctgc
tgcgtgcaattcgcacttgtgctgtggaacaagaatcaccccagcatcttcttccaacag
accgcccaccatcgctttacaaaggaggagagcgactgggggttcactaggttcctggag
tcgcggaagatgttcaacacggtctgggaaaatgccgaccgaccgcttgttgataacgac
tgcatcaacatcagcgcatacgtgcgggttgtcgaggacgaaacgggcgtcctatggcat
aacttcaacaactacgactcaaagaaggagacgggctacgtcggcctcaagaaccagggc
gcgacgtgctatctgaattcgctcctgcagtcattatacttcacgaatgccttccggaag
gccatttatcgaatccctacgcagcaagacgaaagcatgaataacagcgcttacacgctg
cagcggctcttctatcaactgcaaacctccaacacggctgtgggcacctccgagctgaca
aagtcgttcggctgggagacgcgccacatcttcgagcagcaggacgtgcaggagctctcg
cgcaagctcatggagcggatggaggagaagatgaaaggcaccgagttcgagaaggtgctc
ccgcagatgttcagtggcaagatcaagacgtacatctcttgcatcaacgtgccatacgag
tcgagccgggtcgaggatttctgggatgtccagctcaacgtcagcgggaacgagaatctg
ctggatagttttcaggactacatccaggtggagaagctcgacggcgagaaccagtacttt
gccggcgaccagtacaaactgcaagacgccaacaagggcgtcatcttcatgagcttccct
gacgtcttgcatctgcagctgaagaggttcgagtacgacatccagcgcgacgtcatgatg
aagatcaacgatcgatacgagttccccgaggagtttgacgcctctccctacctggacaag
gaggccgacaggtcggaaccctgggattaccagctgcacggcgtcttggtgcatagcggc
gaccaaaatgcgggccattattacgcctttctgaagccgaacaaggagggctggtggtac
aagtacgacgacgacaaggtcaccaaggccacgaaacgggaagttttggaagagaacttc
ggcggtccgatcaagctgcccaacggccagcttcggcccctaggcaacaagaaggggccc
ctgatgcggccgaacagcgcgtacatgctggtatatattcgcaagtcgagactggacaaa
atcctctgtccagtaacagcagacgacacgccggagcacctccgacggcgattcgaggag
gaatacgccgccagggaggcccgccgcaaggagagggaggaacagcacctctatctggga
gtgaaggccatcaccgaagaaacgttccgacatcatggcggcactgacctgacagacttt
gatgcgacgccagaccagaacccggcggcgcctaggttctatcgcgtcctccgttcggcg
acgatgcaagacttggtgaacaagattgctgccgatcttgggcaggacccgagacttgtc
cgcctgtggaatatggtcaaccgccaaaacaagaccacccgcccggatcaacccgtgatg
gacctgcgtccgtctgtggaggagacgtacaacaaggcggcagcgcacagggagcaggcg
ctgcgtgtgtgggtcgaaactaccgaggaagttgacgccgagggcaacgctgtctggccg
acgtactcggggctgccgaacggggtggttgtcaagaacgaccttatcctgctcttcctc
aagtggttcgatgccgaggctcaagctctgagagggatcggccacctgtacatgagcaag
gaaaagaaggttgaggagctgattcccatcatcatgaagaagatgggctgggagaaactg
gcaagcgatgagaagctccagctttgggaggaaatcaaaccgaacatgatcgaaacactg
aaggggaaacaatcactcaaggcggcggagctccaggacggagacatcatctgcttccag
cggcttcacgagcgcaagtcgaggctgggcctgggcgacaagaatgagaggcaatcgtca
gaggaggcagcgaaatcgctggatcgcgccgaggatgcacgcgaatactacgacttcctt
ctcaataagcggacggtcatgttccttgctcacccacaaaaatgcgaccccaaggcgtac
ccgcacttcgagatggttctgaacgccaggatgagctatgacaggctttcggagaaggtt
ggcgagaagctgggggtggagccgacacaccttcggttctatacggtgaatgccagctcc
aacaacccgaggacggccgtcaagcggagccagaaccagacgctcggcaacattctcgtc
ccggcggggtacggtcagttaagtgtcaaccaacggcacgacgccttgttctttgaggtg
ctcgacatgagcctagcggaactagacaccaagaagagcatcaggttgacgcttctgagc
gagggcatcacgaaagaggaacaactcgacgttctggttcccaagaacgggcaggtagag
gacctcatcaactgcttgatcaagaaggcgaagatccccagcgaggaggaggccgggcgg
atccgcatctacgagatcagcaaccacaggttcttccgggagctggatcgaagctacccg
gtgatcagcgtaaacgactacacgacggtgatcgccgagcggataccgagcgaggacgca
gaggttcaagatccgaaccaattcatctctgtattccagttccatggcgaacctagcagg
gcgcacggcattcccttcaggttcctcctcaaggaaggagaaagatttgcggacaccaag
aaacggctggaaaagcggacggggctcaagggcaagagcttcgagaagatcaagtttgcc
gttgttcgccgggcatccttctcaagaccgcagtacttgacagatgatgacatcctttgg
gacgtggcggcgaactctgacgactgcctcggcctcgaccatcccgaccggacgaggtcg
ttgcgtaacggcgccggtgacttgttcctcaggggctag

DBGET integrated database retrieval system