KEGG   Thielavia terrestris: THITE_2108414Help
Entry
THITE_2108414     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K13278  
60kDa lysophospholipase [EC:3.1.1.5 3.1.1.47 3.5.1.1]
Organism
ttt  Thielavia terrestris
Brite
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     THITE_2108414
    3.1.1.47  1-alkyl-2-acetylglycerophosphocholine esterase
     THITE_2108414
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     THITE_2108414
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(join(4366418..4367568,4367762..4367948))
Genome map
AA seq 445 aa AA seqDB search
MRGPMVTEGKGPGSLYPESRVLIIMTGGTICMRDSVDGLVPMAGFLENAMAPRPSFNDNS
PPVKIHAYKNGVKLALDSLRTPPSTYSRHIRYGILEFQPLLDSSSISSLGWTEIAMTIKE
NYHYFDGFVVLHGTDSLAYTASALSFMMSDLGKPVVLTGSQASIFALQSDAVDNLLGSLI
IAGTFVIPEVCLFFHHTLFRGNRTTKVSASAFEAFDSPNCEPLAKVTSLGVDVNWSLVRR
PTRIAEFQVTKYLDTAHVACLRIFPGIKPEMVDSVLRVPNLRGLILETFGMGNAPGGVDG
SLTKVFRQAVERGIVIVNVSQCTNGFVSPLYASGTALGRAGVVFGHDLTTEAALTKLSYL
LALPGLTYADITARMAHSLRGEMTEMTLPSFSHPAGTIDSAVGRLTAAGMLLTQAFCFSL
PKHPLTLSLLLPTLPPSRFPSFHLR
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgaggggaccgatggtcacggaggggaaaggccccggatcgctctacccggagtcccgg
gtactcatcatcatgacgggcggcacaatctgcatgcgggattcggttgatgggctggtc
cccatggcgggcttcctcgagaatgccatggcccctcgtccgtcgttcaacgacaactcc
cctccagtgaaaatccacgcgtataagaacggcgtcaagctggcgctcgacagcctgcgg
acgcctcccagcacctactcgcggcacatccgctatggcatcctcgaattccaaccgctc
ctcgactctagctcgatctcgtccctaggctggaccgagatcgccatgaccatcaaggag
aactaccactactttgacggctttgtggtcctccacggcaccgactcgctcgcctacacc
gcctcggcgctctccttcatgatgtccgacctcggcaagccggtcgtgctcaccggctcg
caggcctccatcttcgcgctgcagtcggacgcggtcgacaacctgctcggctcgctcatc
atcgcgggcaccttcgtcatccccgaagtgtgcctcttcttccaccacacgctcttccgc
ggcaaccggacgaccaaggtgtccgcctcggcgttcgaggcgttcgacagccccaactgc
gagccgctggccaaggtgacgtcgctcggcgtcgacgtcaactggtcgctggtgcgccgc
cccacgcgcatcgccgagttccaggtgaccaagtacctcgacacggcgcacgtggcctgc
ctgcgcatcttcccgggcatcaagcccgagatggtggattccgtgctgcgggtgccgaac
ctgcgcgggctgatcctcgagacgttcggcatgggcaacgcgcccggcggcgtcgacggc
agcctgaccaaggtgttccgccaggccgtcgagcgcggcatcgtcattgtcaacgtcagc
cagtgcaccaacggcttcgtctcgccgctgtacgcgtccggcacggcgctcgggcgggcg
ggcgtcgtgtttggccacgacctgacgaccgaggcggcgctgacgaagctgtcctacctg
ctggcgctgccggggctgacgtacgccgacatcacggccaggatggcgcactcgctgcgc
ggggagatgaccgagatgacgctgccgtccttctcccacccggcgggcaccatcgactcc
gccgtcggcaggctcaccgcggccggtatgttactgactcaagctttttgcttctccctt
cccaaacaccctctcactctctctctcttgctccccacccttcccccttctcgctttcca
tccttccacctccgctaa

DBGET integrated database retrieval system