KEGG   Thielavia terrestris: THITE_2108794Help
Entry
THITE_2108794     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ttt  Thielavia terrestris
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    THITE_2108794
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    THITE_2108794
Enzymes [BR:ttt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     THITE_2108794
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(5108471..5108701,5108759..5108914,5108991..5109333,5109412..5109982,5110088..5110445)
Genome map
AA seq 552 aa AA seqDB search
MASNNMINPAVDPNLEDELFAREVAEVKKWWSDPRWRYTKRPFTAEQIVNKRGNLKIEYP
SNAQAKKLWRILEHRFQNRDASYTYGCLEPTAVTQMAKYLDTVYVSGWQSSSTASSTDEP
GPDLADYPYTTVPNKVGHLFMAQLFHDRKQRQERMSVPKAQRAKLPNIDYLRPIIADADT
GHGGLTAVMKLTKLFIEKGAAGIHIEDQAPGTKKCGHMAGKVLVPISEHINRLVAIRAQA
DIMGSDLIAIARTDAEAATLITSTIDPRDHAFILGCTNPDLPPLNDLMVAAERAGKSGDA
LQAIENDWLAKAGLKRFDEAVLDAITAGAGGDHADKAALAEQYRREVQGKQLSNAEARAV
ARRLLGGRDIHFDWDAPRTREGYYRLRGGCDCSINRAVAYAPYCDAVWMESKLPDYAQAE
EFARGVHAVWPEQKLAYNLSPSFNWKAAMPREEQETYIRRLARLGYCWQFITLGGLHTTA
LASDRFARAFAAQGMRAYGELVQEPEMALGVDVVTHQKWSGAAYVDELQKMVTGGVSSTA
AMGAGVTEEQFH
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaacaacatgatcaatcccgcggtggaccccaacttggaagacgagctgttc
gcccgggaggtcgccgaggtcaagaagtggtggagcgacccgcgatggagatacaccaaa
cggccctttacggccgagcagatcgtcaacaagagaggcaaccttaagatcgagtaccct
agcaatgcgcaggccaagaagctgtggaggattctcgagcaccgcttccagaaccgggat
gccagctacacttacggctgcttggagcccactgctgtcacccagatggccaagtacctc
gacaccgtctacgtctctggctggcagtcgtcgtccaccgcctcgtcgacagacgagccg
ggcccggatcttgccgactacccctataccaccgtgcccaacaaggtcggccacttgttc
atggcccagctcttccacgaccgcaagcagcgccaggagcgcatgtcggtgcccaaggcg
cagcgtgcgaagctccccaacatcgactacctgcgccccatcatcgccgacgccgacacg
ggccacggcggcctgacagccgtcatgaagctcaccaagctcttcatcgagaagggcgcc
gccggcatccacatcgaggaccaggctcccggcaccaagaagtgcggccacatggccggc
aaggtgctggtgcccatcagcgagcacatcaaccgcctggtggccatccgcgcgcaggcc
gacatcatgggctccgatctgatcgccatcgcccgcaccgacgccgaggccgcgacgctc
atcacgtcgaccatcgacccgcgcgaccacgccttcatcctgggctgcaccaacccggac
ctgccgccgctcaacgacctgatggtggccgcggagcgggccgggaagtcgggcgacgcg
ctgcaggccatcgaaaacgactggctggccaaggccgggctgaagcgcttcgacgaggcc
gtgctggacgccatcacggccggcgcaggcggcgaccacgcggacaaggcggcgctggcc
gagcagtaccgccgcgaggtgcagggcaagcagctgtccaacgccgaggcgcgcgccgtc
gcccgccgcctgctcggcggccgcgacatccacttcgactgggacgcgccccgcacccgc
gagggctactaccgcctgcgcggcggctgcgactgctccatcaaccgcgccgtcgcctac
gccccctactgcgacgccgtctggatggagagcaagctgcccgactacgcccaggccgag
gagtttgcgcgcggcgtgcacgccgtgtggccggagcagaaactggcatacaacctctcc
ccctcgttcaactggaaagccgcgatgccgcgcgaggagcaggagacgtacatccggcgg
ctggcgcggctgggctactgctggcagttcatcacgctggggggcctgcacacgacggcg
ctggcgagcgaccggttcgcgcgcgcgttcgcggcgcagggcatgcgcgcctacggcgag
ctcgtgcaggagcccgagatggcgctcggcgtcgacgtcgtcacccaccagaagtggagc
ggcgccgcctacgtcgacgagctccagaagatggtcaccggcggcgtcagcagcaccgcc
gccatgggcgccggcgtcaccgaggagcagtttcattga

DBGET integrated database retrieval system