KEGG   Thielavia terrestris: THITE_2109034Help
Entry
THITE_2109034     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
ttt  Thielavia terrestris
Brite
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     THITE_2109034
Peptidases [BR:ttt01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   THITE_2109034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(5442972..5443619,5443688..5444578,5444635..5444741,5444792..5444954,5445011..5446078)
Genome map
AA seq 958 aa AA seqDB search
MGPVPAGGPPPRRGGRQHYPPVHGYHHGHHGHHGHHPQHVGQPMYAAGYMPAPYVPPAYY
VPQPYQNGAIPAPAGYMPYPNPGYVRSPPAMQHYVPLPQSYGRPPQHSPIVSSPYHPPPP
AAPAVVPPLPHTPSSTHSHAVPPPMTPPVHQVHEVLPAQVPVQQLPQQPESQIDPQAGSQ
PKQQTEVPPPQPSPDALIEPSSTSPIPARKSQFRPPLPWTLDWPFPPRATRLRRRRRALG
SGAERLELPEKPTPATGTPPETHPDVSAQNKEGQESVDVEEQAPSTKPETGPETEASPPQ
SETPSTQAQRSEAAASTSPTSPSSTQPPQAPDAVPGTPTNMAKPATRSAVPAVPAVPVVP
ALPKASPKEAKPAAATVKSSADAEPAVAASGDEQAAKPAKAAENVNGTAEAKTPEAAQPA
AAPAKPRLWAGLFSKPSASAASTSSGAAVSQTQTNGDAAIGRSVVPSAGSFAKANASSLA
HALQAYRPSAPEKLAFLEPRGLVNTGNMCYMNSVLQVLIFCIPFYDFLDQVNKNAAHSFK
SETPLVDAMVMFMREFKVIDSAPSVAQLKKRLKSEDYEKYGEPFTPEFVYDAIRTLPRFA
SMRRGHQQDAQEFLGFLLEGLHDECAQVMRAAPASTASTAPSSSLPSPTSSRANDPLEGG
DDWLEVGPRQRSAVTRSSGHSHTPSPVTKIFGGQLRSELRVPGNKNSVTLEPYQPLQLDI
GSPEIRNIIDALKGLTRPEVLHGDFNSPHGKDVRATKQVFIESVPPVLILHLKRFQFDAE
GYGGTVKIWKKVGYPLEFEFPREVLSRQTRNNILAENSGPPRYRLIAVVYHHGKNASGGH
YTVDVRRQDGREWIRIDDTVIRRVRDEDVAEGGAEEEAGKADGRRDASSAAAGNRFLGIS
DEDAGDDDGWKQAAGGKKWSSVVNGSAPKAVNGQKAKQQHQESMKENKVAYLLFYQRI
NT seq 2877 nt NT seq  +upstreamnt  +downstreamnt
atgggccccgtgcccgccggaggccctcctcctcgccgcggcggccggcagcactacccg
cccgtccacggctaccaccatggccaccacggtcaccacggccaccacccccagcatgtc
ggccagcccatgtacgccgccggctacatgcccgccccgtatgttccgcccgcctactac
gtcccccagccgtaccagaacggcgccatccccgccccggccggttacatgccgtatccc
aaccccggctacgtccggtcaccgcccgccatgcaacactatgtgcctctgccgcagagc
tacggtcggccgccccagcactccccgattgtgtcctcaccctaccatcctcccccgccg
gcagcaccggccgtcgtcccacccctcccgcatacaccatcttcgacacactctcatgca
gttcctccacccatgactcccccggttcaccaggtgcacgaggttcttccagcccaggtg
cccgtgcagcagctacctcagcaaccagaatcccaaatcgacccccaagctggatcgcaa
ccaaagcagcaaacagaagtcccgcctccgcaaccttcgcctgatgcgctgatcgaaccg
tcgtcgactagtcctattccagcccgcaaatctcaattcagaccaccgcttccttggact
cttgactggccgtttcccccgcgagccacgaggctgcggaggcggagaagggctctcggt
tccggtgctgagcgactggagttgcccgagaaacccacaccggcaacgggcacccctcct
gagacccacccggatgtctctgcccagaacaaggaaggccaggagtcggttgacgtcgag
gaacaagccccgagcactaaaccggaaacggggcccgagactgaggcctcccctccccaa
tctgagaccccatcgacacaagcacagcgttccgaagctgccgcctccacttccccaaca
tcgccaagctcgacgcaaccgccccaggctccagacgctgtcccaggcacgccgacgaac
atggcgaagccggcgacacgatcggccgtacctgccgtccctgcggtcccagtggttccg
gctctgccgaaagccagccccaaagaggccaagcctgcagccgccactgtgaagagttcc
gccgacgccgaacccgccgtcgccgcatctggcgatgagcaagccgctaagcccgccaaa
gcggccgagaatgtgaatgggaccgccgaggcgaagacgcctgaggcggcccaaccagca
gctgctccggccaagcccaggctgtgggcgggtctgttctccaagccgagcgcgtcggcc
gccagcacgagctctggtgccgctgtttcacaaacccaaacgaacggcgacgcagccatt
gggcggagtgtggtgccctccgccggcagcttcgcgaaggccaacgccagctcgctcgcc
catgctcttcaggcctaccgtccaagtgcgccggagaagctcgcctttttggaaccgaga
gggctggtgaacacgggcaacatgtgctatatgaattcggtgttacaagttctcatcttc
tgtattcctttctatgacttcttggatcaagtcaacaagaacgccgcccacagcttcaag
agcgagacgcccttggtggatgccatggtcatgttcatgcgcgaattcaaagtgattgac
tcggctccgtcggtggcccagctcaagaagcgcctcaagagcgaagactacgagaagtat
ggggagccgttcacccctgagtttgtctacgatgccatccggacgcttccacgctttgcg
agcatgaggcgcggccatcagcaagacgcccaggagttcctcgggttcctcctcgagggc
ctccatgacgagtgtgcgcaggtgatgcgtgctgctcccgcgtcgaccgcttcgaccgct
ccgagttcgtccctgccttccccgacgtcttcccgagcgaatgacccgctggagggtggc
gacgactggctcgaggtgggaccccgccagcgttcggcggtgacgcggtcgtcgggccat
tcccataccccgtcgcccgtcaccaagatcttcggagggcagctccgttccgaactgcgg
gtgccgggcaacaagaactcggtcacgctggagccgtaccagccgctgcagctcgacatc
ggctcccccgagatccgcaacatcatcgatgcgctgaagggcctcacgcggcccgaggtg
ctccacggcgacttcaactcaccgcatggcaaggacgtccgggcgaccaagcaggtcttt
atcgagtccgtgccgccggtgctgatcctgcacctgaagcgcttccagttcgacgccgag
ggctacggcggcaccgtcaagatctggaagaaggtcggatatccgctggagttcgagttc
ccgcgggaggtgctgtcgcgccagacgcgcaacaacattctcgccgagaactcgggcccg
ccgcggtaccgcctcatcgcggtcgtgtaccaccacggcaagaacgccagcggtgggcat
tacacggtcgatgtgcgccggcaagacgggcgggagtggatccgcatcgacgataccgtc
atccggcgggtgcgggacgaggacgtggccgagggcggcgctgaggaggaggcgggcaag
gcggacgggcggagggacgcgagcagtgctgcggccgggaaccgcttcctcggcatcagc
gacgaggacgcgggcgacgacgatggctggaagcaagcagccggcggcaagaagtggagc
agcgtcgtcaacgggtcggcgccgaaggccgtcaacggacagaaagccaagcagcagcac
caggagagcatgaaggagaacaaggtggcctatctgctgttttaccagcggatctga

DBGET integrated database retrieval system