KEGG   Thielavia terrestris: THITE_2109651Help
Entry
THITE_2109651     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ttt  Thielavia terrestris
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ttt00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:6919652..6920941
Genome map
AA seq 429 aa AA seqDB search
MPVGKSEGPLRSRANLFRTHPSLTIILSLLILILAIFTSASTSVIPRLGLLFGHLTPRHT
PATTTRHVTTAATMTTIYAAELEVAQLAVQRAAQLTKRVFREKGTKGAVAKDDASPVTVG
DFGAQALIIAALRARFPHDAIVAEEEAAPLRTDAALRERIWRLVRETRLDDVAAEGLLGG
AVADVEDMLALIDRGKSEGGRRGRVWTIDPIDGTKGFLRGGQYAVALALLENGDVKVGVL
GCPNLPVDDAAPLTADIGANQTDEEGRGVIFSAVIGQGAWSRPLGTGALAEGKRISMKPI
TEMSSASFCESVEAGHSNQSEAAQIAQKLGITKPSVRMDSQAKYGSIARGAGDIYLRLPT
SKTYQEKIWDHAAGDLIVREAGGQVTDTKGQRLDFGVGRTLATNSGVVAAPAAVHGQVLE
AVQEVLGLK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtgggaaaatccgaggggccactgcgatccagagccaacttgttcagaactcac
ccgtcattgaccatcatcctctcgctcctgatcctgatcctggccatcttcacctccgcc
agcaccagcgtcatcccccgcctcggcctgctcttcggccacctcactccccgacacacc
ccggccaccaccacccgccacgtgacaacagcagcaacaatgaccaccatctacgccgcg
gagctggaagtcgcgcagctggccgtgcagcgcgcggcgcagctgaccaagcgcgtcttc
cgcgagaaggggaccaagggcgcggtggccaaggacgacgcgtcgccggtgacggtgggc
gacttcggcgcgcaggcgctgatcatcgccgcgctgcgcgcgcgcttcccgcacgacgcc
atcgtcgccgaggaggaggccgcgccgctgcggacggacgcggcgctgcgcgagcgcatc
tggcggctcgtgcgcgagacccgcctggacgacgtcgcggccgaggggctgctgggcggc
gcggtcgcggatgtggaggacatgctggcgctgattgatcgcgggaagagcgagggcggc
cggcgcggccgggtgtggacgatcgatccgatcgatgggaccaaggggtttctgaggggc
gggcagtacgcggtggcgctggcgctgctggagaatggggatgtgaaggtgggcgtgctc
gggtgcccgaacctgccggtggacgatgccgcgccgttgacggcggatatcggcgccaac
cagacggatgaggaggggaggggcgtgatcttctcggcggtcatcgggcaaggggcttgg
agcaggccgctgggcacgggcgcgctggccgagggcaagcggatctcgatgaagccgatc
acggagatgtcgagcgcgagcttctgcgagagcgtcgaggcgggccactcgaaccagtcc
gaggccgcgcagatcgcgcagaagctgggcatcaccaagcccagcgtccggatggactcg
caggccaagtacggctccatcgcccgcggcgcgggggatatctatctgcgtctcccgacg
tccaagacataccaggagaagatctgggaccacgcggcgggcgacttgatcgtcagggaa
gcgggcggtcaggtcacggataccaaggggcaacggcttgacttcggcgtcggcaggacg
ctggcgaccaacagcggtgtggttgcggcgccggcggcagttcacggccaggttctagag
gctgttcaagaggttcttgggctaaaatga

DBGET integrated database retrieval system