KEGG   Thielavia terrestris: THITE_2109695Help
Entry
THITE_2109695     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
ttt  Thielavia terrestris
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    THITE_2109695
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     THITE_2109695
Peptidases [BR:ttt01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   THITE_2109695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(6980887..6983067,6983128..6984051)
Genome map
AA seq 1034 aa AA seqDB search
MVGSSVVVNHAGAAPVGGFDGRAGGANGGQRPLLHIDDITSVTVGIDDHAPVEKVLQMAE
YCLRQAESSKAFGRPDLALKDYIRTNIILLDTIKKNKGWPSLQRDSRTQFERYQRLLRQV
HAAHSEFEAIKAQIKADNARTGVQPTSPRPGVPADGVTQPAENGIVDGHDKVTRLNGSQV
VKENGVAASPAPSTPKSKPVVHPKPQKLQGNAVGSVKAQDLVQRFANLRASTANATQDPR
IRTRPIVLPEVPEPRNPPGLPPPSAPVTGVIAEMPRIPDAVYNPPRGTISSETAALPSSA
PRAMFTRTDSTASLNAARSGKPPYAATESSAPSQTSGLTSAPAKRTKLSIPDGDTISVED
LIQFMRAGARDLSILLIDIRSREEFDQGHIMSQATICLEPEVLSRGHISANQIADSMVLA
PATEQLLFEKRHEFDLIVFYDQDSTRIPDNPQTVEERAVSGLFNALSRYDFSDGPGQKPG
PRLLRGGLDAWTSLVGSASLQSSSTITTKKYTVTPLAKSFLTPRQKYVTRPIQDPAEAKR
WEDTIADAGALSVVRTTEDFLRRFPPISDYKESMVAPATPQFDRPQSPFPHQSSHADSLY
SSLPSPPTRPPPAVPRRSYSGLAEADDSSFAMATKPSVMTGGAGRENRTGLQNPGVWCFA
NSSLQAMFATPGFARELWSGSWKDTYQVPKKADERLENPQLLVKMLADLFRWLNQGTFKS
LKAQTLMDYLHHIHSTTADGREKPECEIFGGPSQQDAQEFYSFVLDNIHDETNVRRDRNP
PKEEKPFTPKDGSIIRNAIDYWRDHSNTSASIVDKYFRGLEVFISSCHNRGCRQELRLFQ
PCDVWILNLAGMGDETDLDSLLAGHQTSEYFEDLVCETCNKPGRSRKAKFARLPDRLVFC
LNRFQNAGDSSTRLRSSGKLHTKVRFPIRDLDLTRYCAEPDPDMTVTDDRHFAGRMLYDC
YAVTVHVGQGINGGHYYSYVQDETSADPTDWFRCNDQNVSRVKIGSAQSRDMTETMYQKG
NTSAYMVFYRRRGT
NT seq 3105 nt NT seq  +upstreamnt  +downstreamnt
atggtggggtcaagcgtcgtggtgaaccatgctggggctgcgcctgtgggtggcttcgac
ggacgggccggcggtgcaaatggggggcagcggccactgctgcacattgacgacatcacc
tcggtcactgtcgggatcgacgaccacgcccccgtggagaaggttttacaaatggccgag
tactgtctgcggcaggccgagtcctccaaggcatttggccggcccgatctcgctctgaag
gactacatccggaccaacattatcctgctggacaccatcaagaagaataaggggtggcct
tctctccagagggatagcaggacccagttcgagcgctaccagcggctcctgcgccaggtt
cacgctgctcacagcgagttcgaagccatcaaagcgcagatcaaggccgataatgccagg
acgggcgtccagcccacaagtccccggccaggcgtacccgcggacggggtaacgcagcca
gctgaaaatggcatcgtggacggccacgacaaggtcacccgtctgaatggtagtcaggtc
gtgaaggagaatggtgttgccgcgtcccctgcgccgtctacgcccaagagcaagcccgtt
gtgcaccccaaaccccagaagctccaagggaatgccgtaggctcggtcaaggctcaggat
ctcgttcagcgctttgcgaatctgcgtgcgagtacggccaatgcgacgcaagacccgcgc
attcgaacgcgaccgatcgtgctgccagaagtgccggagccccgaaatcccccggggttg
ccccctccaagtgcgcccgtcacgggggtcatcgccgagatgcctaggatacccgacgct
gtttataacccaccgagagggactatttcgagcgagactgccgcgctgccttcgagcgcg
cctcgagccatgttcacgagaacagactcaaccgcatcgcttaacgccgcgaggagcggc
aagccaccttatgccgctactgaaagctcggcacccagtcagacctctggcctgacaagc
gctccagccaagcggacgaaactgtctattcctgacggcgacaccatctctgtcgaggac
ctgatccaattcatgcgggccggtgccagagatctctccattctactcattgacatcaga
agccgcgaggaatttgaccagggtcacatcatgtcccaagcgactatatgcctcgaaccc
gaagtgctgtcgcgcgggcatatctcggcaaaccagatcgcagatagcatggtgctggcg
ccggcaacagagcaactgctctttgaaaagagacacgagtttgacttgatagtgttctat
gatcaggattccacacgcatccccgataatccgcaaacagtcgaggagagagcggtgtcc
ggccttttcaatgctctcagtcgatacgatttctcggacgggccagggcagaagccggga
ccgaggctgctgcggggcggccttgatgcatggacgagcctggtcggcagcgcgagtctg
cagtcgtcatcgacaattacaacaaaaaagtacacggtgacgccgctggcgaagtcgttc
ctgaccccgcgccagaaatacgtaacccggccaatccaagatccggcagaagcgaaacgg
tgggaagacacaatcgcggatgccggcgctctctccgtagtcaggacaaccgaggatttt
ctccgccggttccctccaatttcggattacaaggagtcgatggtcgctccggccacacca
caattcgaccgtcctcagagcccatttccacaccaatcctctcatgccgacagtctttac
agctctctcccttcgccacctacacgtccacccccagcagttccccggaggagctacagt
gggctcgccgaagccgacgacagctctttcgccatggcgacgaagccttcagtcatgacc
ggcggtgcgggacgggaaaatcggacggggttgcagaatccgggcgtgtggtgcttcgcg
aacagctctttacaggctatgttcgctacgcccggttttgcgcgggaactgtggtcgggg
tcttggaaggacacataccaggttcccaaaaaggccgatgagaggttggagaatccccag
cttctcgtcaagatgctggccgacctgtttcgttggctcaaccaagggactttcaagtcg
ctcaaggcccagacgctcatggattatctccaccacatacactccacaactgccgacggg
agggagaaacccgaatgcgagatctttggtggcccgtcccagcaagatgcacaggagttc
tattcgtttgtgctggacaacatccacgacgagacaaacgttcgccgcgacagaaacccg
cccaaggaagaaaagcccttcaccccgaaggatggcagcatcattcgcaacgccatcgac
tactggcgcgaccactcaaacaccagcgcctccatcgtcgacaagtacttccggggtctg
gaggtcttcatctcgtcctgccacaaccgcggctgccggcaggaactgcgcctcttccag
ccctgcgacgtctggatcctcaacctagccggcatgggcgacgagaccgatctggacagt
ctgctggccggccaccagacgtcagaatacttcgaagacctcgtgtgcgaaacgtgcaac
aagccggggcgctcgcgcaaggccaagttcgcccgcctgcccgaccggctggtcttctgc
ctcaaccggttccagaacgccggcgactccagcacccggctccggtcgtcgggcaagctg
cacaccaaggtgcgcttccccatccgggacctcgacctgacgcgctactgcgccgagccg
gacccggacatgacggtgacggacgaccggcacttcgccggccgcatgctgtacgactgc
tacgccgtcacggtgcacgtcggccagggcatcaacggcgggcactactacagctacgtg
caggacgagacctcggccgacccgaccgactggttccggtgcaacgaccagaacgtgagc
cgcgtcaagatcggcagcgcccagtcccgcgacatgaccgagaccatgtaccagaagggg
aacacgtcggcgtatatggtgttttatcggcggagggggacgtga

DBGET integrated database retrieval system