KEGG   Thielavia terrestris: THITE_2109818Help
Entry
THITE_2109818     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ttt  Thielavia terrestris
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    THITE_2109818
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     THITE_2109818
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     THITE_2109818
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(join(7256547..7257484,7257540..7257589,7257639..7257813,7257887..7257905))
Genome map
AA seq 393 aa AA seqDB search
MPEIAEVARIVHYLRLHLVGKSIKSVKAIEDTNVFGKAGTTGPEVAEALTGKKVLSAGSQ
GKYFWLVLDKPPHPVMHFGMTGWIHIKGDRTAYTNYYKKMKPEELDAWPPKYWKFHLKTE
DPTVEIAFTDPRRFGRVRLVDCPGESIRKYSPLVENGPDPVVDTDVFTEGYLRDKMRSRH
VPIKALILDQSVISGIGNWVGDEVLYQAKLHPEQYCDDFTDEQIKRLYEAIRYVCQFAVD
KLGDSDEFPKDWLFHYRWNKGAKGAVGHLPSGERLAFLTVGGRTSCYVPDVQKKSGRIVP
GVKEKLIESDQGESKPKQPAKSKGAKGEDDQPQNKKRRKAEDDEAPAKKSKTASTKTPTN
GGRKGVKMEEKAAVANNVEPGRRRSGRLQGKAA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagattgccgaggtcgcccgcattgtgcactacctgcgcctacacctggtcgga
aagtcgatcaagagcgtcaaggcgatagaagataccaatgtgttcggcaaggctggtact
acggggcccgaggttgccgaggcgttgacgggcaaaaaggttctctcggcgggctcacag
ggcaaatacttttggcttgttctcgacaaaccgccccatccagtaatgcacttcggcatg
acaggctggatccacattaagggcgaccgaacagcatacaccaactattacaagaaaatg
aagcctgaggaattggacgcctggcctccgaagtactggaagttccacctgaagaccgaa
gatccgacggtcgagatcgctttcactgatcccaggcgcttcggccgtgtccgcctggtc
gattgccccggcgagagcatcagaaagtactcaccgctcgtcgaaaacgggccggatccc
gtggtcgatacagatgtcttcaccgaggggtacctgcgagacaagatgcgctcgcgccac
gtgcccatcaaggccctcattctcgatcagagcgtcatcagcgggatcggcaactgggtc
ggtgacgaagttctctatcaagccaagcttcatcctgagcagtactgcgatgacttcacc
gacgagcagatcaaaagactgtacgaggccatccgttacgtatgccagtttgcggttgac
aaactcggggattccgacgagtttcccaaggactggttgttccactaccgatggaacaag
ggcgcgaaaggggcggtgggtcatcttcccagcggcgaaaggttggcctttcttaccgtg
ggcgggaggacaagctgttacgtgccggacgtccagaagaagagcggccgcatcgtcccg
ggggtaaaggagaagctcattgaatccgaccagggagaatcgaagccgaagcaacccgcg
aagtcgaagggtgccaaaggcgaggatgaccagccccagaacaagaaaaggagaaaggca
gaggacgacgaggcaccggcaaagaagagcaaaactgcttcgacgaagacgccaacaaat
ggtgggcggaagggggtcaagatggaagaaaaagcggcagtggctaataacgtcgagccc
ggcaggcggcgttctggaaggctgcaaggaaaggctgcttga

DBGET integrated database retrieval system