KEGG   Thielavia terrestris: THITE_2110152Help
Entry
THITE_2110152     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ttt  Thielavia terrestris
Pathway
ttt00010  Glycolysis / Gluconeogenesis
ttt00051  Fructose and mannose metabolism
ttt00052  Galactose metabolism
ttt00500  Starch and sucrose metabolism
ttt00520  Amino sugar and nucleotide sugar metabolism
ttt01100  Metabolic pathways
ttt01110  Biosynthesis of secondary metabolites
ttt01130  Biosynthesis of antibiotics
ttt01200  Carbon metabolism
Module
ttt_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ttt_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THITE_2110152
   00051 Fructose and mannose metabolism
    THITE_2110152
   00052 Galactose metabolism
    THITE_2110152
   00500 Starch and sucrose metabolism
    THITE_2110152
   00520 Amino sugar and nucleotide sugar metabolism
    THITE_2110152
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    THITE_2110152
Enzymes [BR:ttt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     THITE_2110152
Membrane trafficking [BR:ttt04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    THITE_2110152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 11523426
NCBI-ProteinID: XP_003650563
JGI: Thite2_2110152
UniProt: G2QRT3
Position
1:join(7854732..7855330,7855386..7855958,7856025..7856565)
Genome map
AA seq 570 aa AA seqDB search
MASLRDVLVAALKSLLRGRSFLKALFAFWSTGPVTPVVPGKTQDVGATKPQTDPAGEFLA
EAEQLLLGYIAAGGLRRFSRKLKRQFRERLRSNPTCMLPSYNSQLPTGHESGRYLALDVG
GSTLRVALVELRGREAPGADSGIVRMDSFKIDSDVRNLRGAAFFDWMAERIHRTVASDIA
KGHGPENPLLVGLAWSFPIEQTSSRGGKLSGMGKGFLANDGLVGEDLGEIIKTACRKQGL
HVELSAIVNDSSAALLSEAYGTPSTRFSLILGTGVNIAVHLPVLTIDRPKFGDRPASWHE
KASHVIVNTELGMFGHDILPLTKWDKLLKDAHPRPDFQPLEQLVSGYYLGEICRLALLDA
IPAAGVFGGVVPPSLLTPYSLDTETLSLIEADTTPSLSSAISTFAARHPTPDYHPTTNDI
RFLRSLSSLIARRSASLVAASLFALWELKSEAEQALLSSLSETTTTPSPSSSSSPPSSSS
SSSSSAFAAETAAELQLAQGTTTVAFNGSVVEQYPGYRGYLQGFVDRLLEEEEDEDGNGG
GAGQSKGKIALVEARESSLRGAAVALACLS
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgctgcgggatgtgctcgtggctgctctcaagtctctccttcgcggccggtcg
tttctaaaagcactcttcgccttctggtcaactggacccgtcacccctgtcgttccgggc
aagacgcaagatgtcggcgccaccaagccccaaaccgacccggccggcgagttcctggcc
gaggccgaacaacttctcctggggtacatcgccgctggcggcctgaggcggttctcacgg
aaactgaagcgccagttccgcgagcgtctgcggtcgaacccgacctgcatgctaccctca
tacaactcccagctacctaccggccacgagtctggccgctatctcgccctcgacgttggc
ggatcgacactacgcgtggccctggtggagctaagagggcgtgaggcacccggagccgac
agtggcatcgtcaggatggactccttcaagatcgacagcgacgtgaggaatctcaggggg
gccgccttcttcgactggatggccgagaggatacaccggacggtggcaagtgacattgcc
aagggccacggcccagagaacccgctcttggtcgggcttgcctggagtttccccatcgag
caaacttcatcaagaggtgggaaactgtcaggcatgggcaaaggcttcctcgccaatgac
ggcctcgttggcgaagatctaggcgagatcattaagaccgcctgccgcaaacagggattg
catgttgagctctcggccatcgtcaacgattcaagcgccgcactgctctcagaagcttac
ggcaccccgtcgacgcgcttcagcctcatcctcgggacaggcgtcaacattgccgtccat
ctgcccgtgctgaccatcgaccggcccaaattcggcgaccggcccgccagctggcacgag
aaagcaagccacgtgatagtgaacaccgagctgggcatgtttggccacgacatcctcccg
ctgacaaagtgggacaagctgctcaaggatgcgcatcccaggcccgacttccaaccgctc
gagcaactcgtcagcggatactacctcggcgagatctgccggctcgccttgctcgacgca
atccccgcggcaggcgtcttcgggggcgttgtcccgccgtctctcctcaccccgtactcc
ctcgataccgaaacgctctcgctaatcgaagccgacaccaccccaagcctgtcaagcgcc
atttcaacgttcgccgcccgccatcccacgccagactaccaccccacgaccaatgacatc
cgcttcttgcgcagcctctcctccctcatagctcgccgctccgcctccctcgtagcggcc
tcccttttcgcgctctgggagctcaaatccgaagccgaacaggcgctcctctcgtctctg
tccgaaacgactacaacgccgtctccatcttcctcgtcatcaccgccctcgtcgtcatca
tcatcatcatcgtcggccttcgcggcagagacggcagctgagctgcagctcgcgcagggc
acgaccacggtggcgtttaacggcagcgtggtggagcagtatcctgggtatagagggtat
ctgcagggctttgttgacaggttacttgaggaagaggaggacgaggatgggaacggtggt
ggtgctgggcagagtaaagggaagatcgcgttggtggaggcgcgggagagttcgctccgg
ggcgcggccgtagcgctggcttgtttatcttga

DBGET integrated database retrieval system