KEGG   Thielavia terrestris: THITE_2110152Help
Entry
THITE_2110152     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K00844  
hexokinase [EC:2.7.1.1]
Organism
ttt  Thielavia terrestris
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:ttt01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ttt00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ttt00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ttt00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ttt00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ttt00520]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(7854732..7855330,7855386..7855958,7856025..7856565)
Genome map
AA seq 570 aa AA seqDB search
MASLRDVLVAALKSLLRGRSFLKALFAFWSTGPVTPVVPGKTQDVGATKPQTDPAGEFLA
EAEQLLLGYIAAGGLRRFSRKLKRQFRERLRSNPTCMLPSYNSQLPTGHESGRYLALDVG
GSTLRVALVELRGREAPGADSGIVRMDSFKIDSDVRNLRGAAFFDWMAERIHRTVASDIA
KGHGPENPLLVGLAWSFPIEQTSSRGGKLSGMGKGFLANDGLVGEDLGEIIKTACRKQGL
HVELSAIVNDSSAALLSEAYGTPSTRFSLILGTGVNIAVHLPVLTIDRPKFGDRPASWHE
KASHVIVNTELGMFGHDILPLTKWDKLLKDAHPRPDFQPLEQLVSGYYLGEICRLALLDA
IPAAGVFGGVVPPSLLTPYSLDTETLSLIEADTTPSLSSAISTFAARHPTPDYHPTTNDI
RFLRSLSSLIARRSASLVAASLFALWELKSEAEQALLSSLSETTTTPSPSSSSSPPSSSS
SSSSSAFAAETAAELQLAQGTTTVAFNGSVVEQYPGYRGYLQGFVDRLLEEEEDEDGNGG
GAGQSKGKIALVEARESSLRGAAVALACLS
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgctgcgggatgtgctcgtggctgctctcaagtctctccttcgcggccggtcg
tttctaaaagcactcttcgccttctggtcaactggacccgtcacccctgtcgttccgggc
aagacgcaagatgtcggcgccaccaagccccaaaccgacccggccggcgagttcctggcc
gaggccgaacaacttctcctggggtacatcgccgctggcggcctgaggcggttctcacgg
aaactgaagcgccagttccgcgagcgtctgcggtcgaacccgacctgcatgctaccctca
tacaactcccagctacctaccggccacgagtctggccgctatctcgccctcgacgttggc
ggatcgacactacgcgtggccctggtggagctaagagggcgtgaggcacccggagccgac
agtggcatcgtcaggatggactccttcaagatcgacagcgacgtgaggaatctcaggggg
gccgccttcttcgactggatggccgagaggatacaccggacggtggcaagtgacattgcc
aagggccacggcccagagaacccgctcttggtcgggcttgcctggagtttccccatcgag
caaacttcatcaagaggtgggaaactgtcaggcatgggcaaaggcttcctcgccaatgac
ggcctcgttggcgaagatctaggcgagatcattaagaccgcctgccgcaaacagggattg
catgttgagctctcggccatcgtcaacgattcaagcgccgcactgctctcagaagcttac
ggcaccccgtcgacgcgcttcagcctcatcctcgggacaggcgtcaacattgccgtccat
ctgcccgtgctgaccatcgaccggcccaaattcggcgaccggcccgccagctggcacgag
aaagcaagccacgtgatagtgaacaccgagctgggcatgtttggccacgacatcctcccg
ctgacaaagtgggacaagctgctcaaggatgcgcatcccaggcccgacttccaaccgctc
gagcaactcgtcagcggatactacctcggcgagatctgccggctcgccttgctcgacgca
atccccgcggcaggcgtcttcgggggcgttgtcccgccgtctctcctcaccccgtactcc
ctcgataccgaaacgctctcgctaatcgaagccgacaccaccccaagcctgtcaagcgcc
atttcaacgttcgccgcccgccatcccacgccagactaccaccccacgaccaatgacatc
cgcttcttgcgcagcctctcctccctcatagctcgccgctccgcctccctcgtagcggcc
tcccttttcgcgctctgggagctcaaatccgaagccgaacaggcgctcctctcgtctctg
tccgaaacgactacaacgccgtctccatcttcctcgtcatcaccgccctcgtcgtcatca
tcatcatcatcgtcggccttcgcggcagagacggcagctgagctgcagctcgcgcagggc
acgaccacggtggcgtttaacggcagcgtggtggagcagtatcctgggtatagagggtat
ctgcagggctttgttgacaggttacttgaggaagaggaggacgaggatgggaacggtggt
ggtgctgggcagagtaaagggaagatcgcgttggtggaggcgcgggagagttcgctccgg
ggcgcggccgtagcgctggcttgtttatcttga

DBGET integrated database retrieval system