KEGG   Thielavia terrestris: THITE_2110152Help
Entry
THITE_2110152     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K00844  
hexokinase [EC:2.7.1.1]
Organism
ttt  Thielavia terrestris
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    THITE_2110152
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THITE_2110152
   00051 Fructose and mannose metabolism
    THITE_2110152
   00052 Galactose metabolism
    THITE_2110152
   00500 Starch and sucrose metabolism
    THITE_2110152
   00520 Amino sugar and nucleotide sugar metabolism
    THITE_2110152
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    THITE_2110152
Enzymes [BR:ttt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     THITE_2110152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(7854732..7855330,7855386..7855958,7856025..7856565)
Genome map
AA seq 570 aa AA seqDB search
MASLRDVLVAALKSLLRGRSFLKALFAFWSTGPVTPVVPGKTQDVGATKPQTDPAGEFLA
EAEQLLLGYIAAGGLRRFSRKLKRQFRERLRSNPTCMLPSYNSQLPTGHESGRYLALDVG
GSTLRVALVELRGREAPGADSGIVRMDSFKIDSDVRNLRGAAFFDWMAERIHRTVASDIA
KGHGPENPLLVGLAWSFPIEQTSSRGGKLSGMGKGFLANDGLVGEDLGEIIKTACRKQGL
HVELSAIVNDSSAALLSEAYGTPSTRFSLILGTGVNIAVHLPVLTIDRPKFGDRPASWHE
KASHVIVNTELGMFGHDILPLTKWDKLLKDAHPRPDFQPLEQLVSGYYLGEICRLALLDA
IPAAGVFGGVVPPSLLTPYSLDTETLSLIEADTTPSLSSAISTFAARHPTPDYHPTTNDI
RFLRSLSSLIARRSASLVAASLFALWELKSEAEQALLSSLSETTTTPSPSSSSSPPSSSS
SSSSSAFAAETAAELQLAQGTTTVAFNGSVVEQYPGYRGYLQGFVDRLLEEEEDEDGNGG
GAGQSKGKIALVEARESSLRGAAVALACLS
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgctgcgggatgtgctcgtggctgctctcaagtctctccttcgcggccggtcg
tttctaaaagcactcttcgccttctggtcaactggacccgtcacccctgtcgttccgggc
aagacgcaagatgtcggcgccaccaagccccaaaccgacccggccggcgagttcctggcc
gaggccgaacaacttctcctggggtacatcgccgctggcggcctgaggcggttctcacgg
aaactgaagcgccagttccgcgagcgtctgcggtcgaacccgacctgcatgctaccctca
tacaactcccagctacctaccggccacgagtctggccgctatctcgccctcgacgttggc
ggatcgacactacgcgtggccctggtggagctaagagggcgtgaggcacccggagccgac
agtggcatcgtcaggatggactccttcaagatcgacagcgacgtgaggaatctcaggggg
gccgccttcttcgactggatggccgagaggatacaccggacggtggcaagtgacattgcc
aagggccacggcccagagaacccgctcttggtcgggcttgcctggagtttccccatcgag
caaacttcatcaagaggtgggaaactgtcaggcatgggcaaaggcttcctcgccaatgac
ggcctcgttggcgaagatctaggcgagatcattaagaccgcctgccgcaaacagggattg
catgttgagctctcggccatcgtcaacgattcaagcgccgcactgctctcagaagcttac
ggcaccccgtcgacgcgcttcagcctcatcctcgggacaggcgtcaacattgccgtccat
ctgcccgtgctgaccatcgaccggcccaaattcggcgaccggcccgccagctggcacgag
aaagcaagccacgtgatagtgaacaccgagctgggcatgtttggccacgacatcctcccg
ctgacaaagtgggacaagctgctcaaggatgcgcatcccaggcccgacttccaaccgctc
gagcaactcgtcagcggatactacctcggcgagatctgccggctcgccttgctcgacgca
atccccgcggcaggcgtcttcgggggcgttgtcccgccgtctctcctcaccccgtactcc
ctcgataccgaaacgctctcgctaatcgaagccgacaccaccccaagcctgtcaagcgcc
atttcaacgttcgccgcccgccatcccacgccagactaccaccccacgaccaatgacatc
cgcttcttgcgcagcctctcctccctcatagctcgccgctccgcctccctcgtagcggcc
tcccttttcgcgctctgggagctcaaatccgaagccgaacaggcgctcctctcgtctctg
tccgaaacgactacaacgccgtctccatcttcctcgtcatcaccgccctcgtcgtcatca
tcatcatcatcgtcggccttcgcggcagagacggcagctgagctgcagctcgcgcagggc
acgaccacggtggcgtttaacggcagcgtggtggagcagtatcctgggtatagagggtat
ctgcagggctttgttgacaggttacttgaggaagaggaggacgaggatgggaacggtggt
ggtgctgggcagagtaaagggaagatcgcgttggtggaggcgcgggagagttcgctccgg
ggcgcggccgtagcgctggcttgtttatcttga

DBGET integrated database retrieval system