KEGG   Thielavia terrestris: THITE_2110152Help
Entry
THITE_2110152     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
ttt  Thielavia terrestris
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    THITE_2110152
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    THITE_2110152
   00051 Fructose and mannose metabolism
    THITE_2110152
   00052 Galactose metabolism
    THITE_2110152
   00500 Starch and sucrose metabolism
    THITE_2110152
   00520 Amino sugar and nucleotide sugar metabolism
    THITE_2110152
  Biosynthesis of other secondary metabolites
   00524 Butirosin and neomycin biosynthesis
    THITE_2110152
Enzymes [BR:ttt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     THITE_2110152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(7854732..7855330,7855386..7855958,7856025..7856565)
Genome map
AA seq 570 aa AA seqDB search
MASLRDVLVAALKSLLRGRSFLKALFAFWSTGPVTPVVPGKTQDVGATKPQTDPAGEFLA
EAEQLLLGYIAAGGLRRFSRKLKRQFRERLRSNPTCMLPSYNSQLPTGHESGRYLALDVG
GSTLRVALVELRGREAPGADSGIVRMDSFKIDSDVRNLRGAAFFDWMAERIHRTVASDIA
KGHGPENPLLVGLAWSFPIEQTSSRGGKLSGMGKGFLANDGLVGEDLGEIIKTACRKQGL
HVELSAIVNDSSAALLSEAYGTPSTRFSLILGTGVNIAVHLPVLTIDRPKFGDRPASWHE
KASHVIVNTELGMFGHDILPLTKWDKLLKDAHPRPDFQPLEQLVSGYYLGEICRLALLDA
IPAAGVFGGVVPPSLLTPYSLDTETLSLIEADTTPSLSSAISTFAARHPTPDYHPTTNDI
RFLRSLSSLIARRSASLVAASLFALWELKSEAEQALLSSLSETTTTPSPSSSSSPPSSSS
SSSSSAFAAETAAELQLAQGTTTVAFNGSVVEQYPGYRGYLQGFVDRLLEEEEDEDGNGG
GAGQSKGKIALVEARESSLRGAAVALACLS
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgctgcgggatgtgctcgtggctgctctcaagtctctccttcgcggccggtcg
tttctaaaagcactcttcgccttctggtcaactggacccgtcacccctgtcgttccgggc
aagacgcaagatgtcggcgccaccaagccccaaaccgacccggccggcgagttcctggcc
gaggccgaacaacttctcctggggtacatcgccgctggcggcctgaggcggttctcacgg
aaactgaagcgccagttccgcgagcgtctgcggtcgaacccgacctgcatgctaccctca
tacaactcccagctacctaccggccacgagtctggccgctatctcgccctcgacgttggc
ggatcgacactacgcgtggccctggtggagctaagagggcgtgaggcacccggagccgac
agtggcatcgtcaggatggactccttcaagatcgacagcgacgtgaggaatctcaggggg
gccgccttcttcgactggatggccgagaggatacaccggacggtggcaagtgacattgcc
aagggccacggcccagagaacccgctcttggtcgggcttgcctggagtttccccatcgag
caaacttcatcaagaggtgggaaactgtcaggcatgggcaaaggcttcctcgccaatgac
ggcctcgttggcgaagatctaggcgagatcattaagaccgcctgccgcaaacagggattg
catgttgagctctcggccatcgtcaacgattcaagcgccgcactgctctcagaagcttac
ggcaccccgtcgacgcgcttcagcctcatcctcgggacaggcgtcaacattgccgtccat
ctgcccgtgctgaccatcgaccggcccaaattcggcgaccggcccgccagctggcacgag
aaagcaagccacgtgatagtgaacaccgagctgggcatgtttggccacgacatcctcccg
ctgacaaagtgggacaagctgctcaaggatgcgcatcccaggcccgacttccaaccgctc
gagcaactcgtcagcggatactacctcggcgagatctgccggctcgccttgctcgacgca
atccccgcggcaggcgtcttcgggggcgttgtcccgccgtctctcctcaccccgtactcc
ctcgataccgaaacgctctcgctaatcgaagccgacaccaccccaagcctgtcaagcgcc
atttcaacgttcgccgcccgccatcccacgccagactaccaccccacgaccaatgacatc
cgcttcttgcgcagcctctcctccctcatagctcgccgctccgcctccctcgtagcggcc
tcccttttcgcgctctgggagctcaaatccgaagccgaacaggcgctcctctcgtctctg
tccgaaacgactacaacgccgtctccatcttcctcgtcatcaccgccctcgtcgtcatca
tcatcatcatcgtcggccttcgcggcagagacggcagctgagctgcagctcgcgcagggc
acgaccacggtggcgtttaacggcagcgtggtggagcagtatcctgggtatagagggtat
ctgcagggctttgttgacaggttacttgaggaagaggaggacgaggatgggaacggtggt
ggtgctgggcagagtaaagggaagatcgcgttggtggaggcgcgggagagttcgctccgg
ggcgcggccgtagcgctggcttgtttatcttga

DBGET integrated database retrieval system