KEGG   Thielavia terrestris: THITE_2110159Help
Entry
THITE_2110159     CDS       T02228                                 

Definition
glycoside hydrolase family 3 protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ttt  Thielavia terrestris
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ttt00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:ttt00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(join(7860494..7861920,7861982..7863253,7863328..7863446,7863645..7863694))
Genome map
AA seq 955 aa AA seqDB search
MAKLDADLDPLWQDLDWAIGQMLIMGWDGTEVTPQIRNLIEQHHLGSILLTAKNLKSAHQ
TAKLVQELQTIAHQAGHPQPLLIALDQENGGVNSLYDEDYICQFPSAMGQAAAGSSDLAY
KVAKATATEVSAVGVNLVLGPVLDVLTNARYQPLGVRATSDDPQEVSQYGIAAINGYKDA
GVATCGKHFPSYGNLDFLGSSLDIPIITQTLEELSLSALVPFRNAIATGKLDAMFVGGCG
ITNPSMSVNHACLSDQVVDDLLRNELGFQGVAISECLEMEGLRTEIGVKTGTVMAVEAGC
DLVLLCRAYDVQLEAISGLKLGVENELITKERIYTSLRRVLRMKKSCTSWPKALNPPGIS
LLSKIHPSHLALSLKAYDDSIAVIRDNEKLLPLTSSMHQEEELLLLTPLVKPLPASSLTK
ALLEAKSRSETPTMHEKWAHRDRGAIMSGEGVFRELGRSLARARHGKLLHTSYTANGVRP
VHENLINRASCIIIVTADANRNLYQAGFTKHVSMMCSMLRASGQKKSLIVVSVSSPYDFA
MDKSVGTYICTFDFTETAMAALVRVLCGKFKSQGTLPGTLRKSRKAVKSRQHWLVEAYDR
NRDARGLDDLLQSLARASAPAHPFLQTTSAHTFELFNPNIEEAHYVVRNSSTQALYGFCA
TYFVEGTGILGALFVDPAKRNVSIGRSLHRRALRGLTQKRGIKKVQLGMPFPGVFLGIPA
DDSAGLKQWFANGGWDLQFPRRLANMAIGTLSSWKAPEGLLQSIQRANISFDLIHGLDNA
DSVLHHVKAHSNPEVLELYRFALQETKTCGVVRAKGHAESLLGTVIICSPGSALAGSIPP
LQPSASEHDDEPIGGIVAPIVAPSTPQQANLVLQGLALMGLRQNKAHKAVRSVLSWVQDD
ACEPLLAMGFEVVQAFEEFTNSPDNVSVSVALLASAPLMMGWWLTCVVSQWQDLA
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctggacgccgacctggacccactttggcaggatctcgactgggccatcggg
cagatgctgattatgggatgggatggcaccgaggtcacgccccagatccgtaacctgatc
gagcagcaccatctaggctcgatactgttgactgcgaagaacctcaaatctgcccaccag
acggcaaagctcgtccaggagctgcaaaccatcgcccaccaggccggccatccccagccc
ctgttgatcgccctggaccaggagaacggcggcgtcaacagcctctacgatgaggactac
atctgccagttcccgagcgccatgggccaggccgctgccggcagttccgacctggcatac
aaggtcgccaaggccacagcgaccgaagtgtcggccgtcggcgtcaacctggttctcggc
ccggtgctggacgtgctgaccaatgcgcgctaccagccactcggtgtccgtgccactagc
gacgatccccaggaggtctcgcagtacggcatcgccgccataaacggctacaaggacgcc
ggcgtggcgacctgcggcaagcacttcccctcgtatgggaacttggacttcctcggctcc
agcttggacatccctatcatcacccagacgctcgaggagctctccctgagcgctctcgtc
cccttccgcaatgccatcgccaccggcaagctggacgccatgtttgttggtgggtgcggc
atcacgaacccgtccatgagcgtcaaccatgcctgtctgtccgatcaggtggtcgacgac
ctgctcaggaacgagctcggctttcagggcgtcgccatctccgagtgcctggagatggag
ggccttcgaaccgagatcggcgtcaagacgggcacggtcatggctgtcgaagccggctgc
gacctcgtgctgctctgccgcgcctacgacgtacagctcgaggccatctcaggcctcaag
ctcggggtggagaacgagctcatcacgaaggaacgcatttatacatccctgaggcgggtc
cttcgcatgaagaagtcgtgtacctcctggccgaaggccctcaaccctcccgggatatct
ctgctgtccaagatccatcccagccatctggccctctcgttgaaggcctacgatgattcc
atcgccgtcatacgagataacgagaagctactcccgctgaccagctcgatgcaccaagaa
gaggagctgctgttgctgacccccttggtgaagccgctgcccgcgtcgtccctgaccaag
gcacttctcgaggcgaagagtaggtccgagacgccgacaatgcacgaaaaatgggcgcac
cgcgatcgcggagccatcatgagcggcgaaggcgtgttcagggagctcggaagatctctc
gctcgggcccgacacgggaagttgctccacacctcttacactgcgaatggggtcaggcca
gtgcatgaaaacttgatcaaccgggcctcatgcatcatcatcgtgacggccgacgccaac
cggaatctctatcaggcgggcttcacgaaacatgtctccatgatgtgctcaatgctgaga
gcaagcgggcaaaagaagtcgctcattgtggtttccgtcagctcaccttacgactttgcg
atggacaagtcagtagggacctacatctgcacctttgacttcaccgagaccgccatggct
gccctcgtacgggtgctgtgcggcaagttcaagtcgcaggggacgttgccgggcacgctg
aggaagagccggaaggcggtcaaatctcggcagcactggcttgttgaggcttacgaccga
aaccgagacgccagaggactggacgacctcctgcagtccctggccagggcgagcgcaccc
gcgcacccgttcctccaaacaacatcagctcatacgttcgagctgtttaaccccaacatc
gaggaggcgcactacgtggtgcgcaacagcagcacgcaggctctgtacgggttctgcgcg
acctacttcgtcgaaggcacgggaattctcggcgcgctcttcgtggacccggccaagcgc
aacgtgtcgatcggcagatcgctgcaccgcagagctttgcgcgggctgacgcagaaacgg
ggcatcaagaaggtgcaactcggcatgcccttccccggcgtctttctcggcatcccagcc
gatgacagcgccgggctcaagcaatggtttgccaacggcggctgggacctccagttcccg
cggcggctggccaacatggcgatcggaacgctcagcagctggaaggcgcccgagggcctg
ctgcagagcatccagcgggccaacatcagcttcgacctcatccacggcctggacaacgcc
gacagcgtgctccatcacgtcaaggcgcactccaacccggaggtgctcgagctgtaccgg
ttcgctctgcaggagacaaagacatgcggcgtcgtgcgggccaagggccatgccgaaagc
ctgctcggaacagtcatcatctgcagccccggcagtgcgctggccggctccattcccccc
ttgcagccgtccgcgtccgaacacgacgacgagccgatcgggggcatcgtcgcgccgatc
gtggcgccatcgacgccgcagcaggcgaacctggtgctgcagggcctggccctgatgggc
ctgcggcagaacaaggcgcacaaggcggtcaggagcgtgctgagctgggtgcaggacgac
gcgtgcgagccgctgctcgccatgggcttcgaggtggtgcaggcgtttgaggagttcacc
aactcgccggacaatgtgagtgtatctgttgccttgcttgcgagtgcgccgttgatgatg
ggatggtggctgacctgtgttgtctcgcagtggcaagatttggcttag

DBGET integrated database retrieval system