KEGG   Thielavia terrestris: THITE_2110518Help
Entry
THITE_2110518     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
ttt  Thielavia terrestris
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    THITE_2110518
  Replication and repair
   03420 Nucleotide excision repair
    THITE_2110518
Transcription machinery [BR:ttt03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     THITE_2110518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(8513812..8513941,8514002..8515413)
Genome map
AA seq 513 aa AA seqDB search
MSVAPQSYQLSDYLEKLPGTTFRKLYQQPSTAFAIFRRMLPPLAKIFVQALLYMPSPLLL
SELDVWVRPEAKMHRDRALSILRSLHIVQISPPGKDKPQEIQLTTNFKNSLRLALEGGGT
HNSFGVPSTLPVDPRIDIAHLDQYARKKWEDILHYVVNSVPVHAEGGGGGGSGGGPKASV
KDLLLAGRLVERRPDTRGGVAITQAGFTFLLQEANAQVWTLLLLWLEAADHSKAAAAAAG
DHAKGAASQGKPDSIDMLSFLFMLASLELGRAYDTDSLTETRRNMLPALVDFGLIYIPRE
DTRQYFPTRLATTLTSSASALRSVSSGFSAAAANNPGDAASLGMTPDTTPTKGSLIIETN
YRLYAYTSSPLQIAVLALFTQLNMRFAGMVTGRLTRDSIRRAISFGITADQIISYLASHA
HEQMTRAAAAAGRPVLPPTVVDQIRLWQLENERMRTTAGFLFKDFDSPEEYVSLSGYAEE
IGVLVWKSDRKRVFFASKFEQLRDYLKSRKKAE
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtcgcgccgcagtcgtaccagctctccgactacctggagaagctgcccggcacc
actttccgcaagctctaccagcagccgtcaactgcctttgccatcttccgccgcatgctg
ccgcccttggccaagatctttgtccaggcgctcctctacatgccgtcgcccctgctgctc
tccgagctcgatgtctgggtgcgtcccgaggccaagatgcaccgcgaccgtgccctttcg
attctgcgctctctgcacattgtccagatctccccgcccggcaaggacaagccgcaggag
atacagctcacgacaaatttcaagaacagtctgcgcctggccctcgagggtggcgggaca
cacaacagcttcggcgtgccgagcaccctgcccgtcgacccccggatcgacatcgcccac
ctcgaccagtacgcccgcaagaaatgggaggacatcctgcactacgtcgtgaatagcgtg
cccgtgcatgccgagggaggaggcgggggcggctcgggcggcggccccaaagccagcgtc
aaggacttactgctagcaggacgtctggtcgagcgaagacccgacacaagaggcggcgtc
gccatcacccaggcgggcttcaccttcttgctccaggaagccaacgcccaggtctggacg
ctgctcctcctctggctcgaagccgcagaccactccaaggcagcagcagcagcagcaggg
gaccacgccaaaggggcggcgagccagggaaagcccgacagcatcgacatgctctcgttc
ctattcatgctcgcctcgctcgagctaggccgcgcctacgacaccgactcgctcaccgag
acgcggcgcaacatgctcccggcgctcgtcgacttcggcctgatctacatcccgcgcgaa
gacacgcgccagtacttcccgacgcgcctcgccacgacgctgacgagctccgcctcggcc
ctgcgctccgtctcgtcgggcttctccgccgccgccgccaacaacccgggcgacgcggcc
agcctcggcatgacgcccgacacgacgccgaccaagggctccctcatcatcgagaccaac
taccggctgtacgcctacacgtcgtcgccgctgcagatcgccgtgctggccctgttcacg
cagctcaacatgcgcttcgcgggcatggtcacgggccggctgacgcgcgactcgatccgc
cgcgccatcagcttcggcatcaccgccgaccagatcatcagctacctggcctcgcacgcg
cacgagcagatgacccgcgcggccgccgccgcggggcggcccgtgctgccgcccactgtc
gtcgaccagatccgcctgtggcagctcgagaacgagcggatgcgcaccaccgccggcttc
ctgttcaaggacttcgactcgcccgaggagtacgtctcgctgagcggctacgccgaggag
atcggcgtgctggtgtggaagagcgaccggaagcgcgtcttcttcgccagcaagttcgag
cagctgcgggactacctcaagagtcggaagaaggccgagtga

DBGET integrated database retrieval system