KEGG   Thielavia terrestris: THITE_2110518Help
Entry
THITE_2110518     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
ttt  Thielavia terrestris
Pathway
Basal transcription factors
Nucleotide excision repair
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:ttt03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:ttt03420]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(8513812..8513941,8514002..8515413)
Genome map
AA seq 513 aa AA seqDB search
MSVAPQSYQLSDYLEKLPGTTFRKLYQQPSTAFAIFRRMLPPLAKIFVQALLYMPSPLLL
SELDVWVRPEAKMHRDRALSILRSLHIVQISPPGKDKPQEIQLTTNFKNSLRLALEGGGT
HNSFGVPSTLPVDPRIDIAHLDQYARKKWEDILHYVVNSVPVHAEGGGGGGSGGGPKASV
KDLLLAGRLVERRPDTRGGVAITQAGFTFLLQEANAQVWTLLLLWLEAADHSKAAAAAAG
DHAKGAASQGKPDSIDMLSFLFMLASLELGRAYDTDSLTETRRNMLPALVDFGLIYIPRE
DTRQYFPTRLATTLTSSASALRSVSSGFSAAAANNPGDAASLGMTPDTTPTKGSLIIETN
YRLYAYTSSPLQIAVLALFTQLNMRFAGMVTGRLTRDSIRRAISFGITADQIISYLASHA
HEQMTRAAAAAGRPVLPPTVVDQIRLWQLENERMRTTAGFLFKDFDSPEEYVSLSGYAEE
IGVLVWKSDRKRVFFASKFEQLRDYLKSRKKAE
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtcgcgccgcagtcgtaccagctctccgactacctggagaagctgcccggcacc
actttccgcaagctctaccagcagccgtcaactgcctttgccatcttccgccgcatgctg
ccgcccttggccaagatctttgtccaggcgctcctctacatgccgtcgcccctgctgctc
tccgagctcgatgtctgggtgcgtcccgaggccaagatgcaccgcgaccgtgccctttcg
attctgcgctctctgcacattgtccagatctccccgcccggcaaggacaagccgcaggag
atacagctcacgacaaatttcaagaacagtctgcgcctggccctcgagggtggcgggaca
cacaacagcttcggcgtgccgagcaccctgcccgtcgacccccggatcgacatcgcccac
ctcgaccagtacgcccgcaagaaatgggaggacatcctgcactacgtcgtgaatagcgtg
cccgtgcatgccgagggaggaggcgggggcggctcgggcggcggccccaaagccagcgtc
aaggacttactgctagcaggacgtctggtcgagcgaagacccgacacaagaggcggcgtc
gccatcacccaggcgggcttcaccttcttgctccaggaagccaacgcccaggtctggacg
ctgctcctcctctggctcgaagccgcagaccactccaaggcagcagcagcagcagcaggg
gaccacgccaaaggggcggcgagccagggaaagcccgacagcatcgacatgctctcgttc
ctattcatgctcgcctcgctcgagctaggccgcgcctacgacaccgactcgctcaccgag
acgcggcgcaacatgctcccggcgctcgtcgacttcggcctgatctacatcccgcgcgaa
gacacgcgccagtacttcccgacgcgcctcgccacgacgctgacgagctccgcctcggcc
ctgcgctccgtctcgtcgggcttctccgccgccgccgccaacaacccgggcgacgcggcc
agcctcggcatgacgcccgacacgacgccgaccaagggctccctcatcatcgagaccaac
taccggctgtacgcctacacgtcgtcgccgctgcagatcgccgtgctggccctgttcacg
cagctcaacatgcgcttcgcgggcatggtcacgggccggctgacgcgcgactcgatccgc
cgcgccatcagcttcggcatcaccgccgaccagatcatcagctacctggcctcgcacgcg
cacgagcagatgacccgcgcggccgccgccgcggggcggcccgtgctgccgcccactgtc
gtcgaccagatccgcctgtggcagctcgagaacgagcggatgcgcaccaccgccggcttc
ctgttcaaggacttcgactcgcccgaggagtacgtctcgctgagcggctacgccgaggag
atcggcgtgctggtgtggaagagcgaccggaagcgcgtcttcttcgccagcaagttcgag
cagctgcgggactacctcaagagtcggaagaaggccgagtga

DBGET integrated database retrieval system