KEGG   Thielavia terrestris: THITE_2110683Help
Entry
THITE_2110683     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
ttt  Thielavia terrestris
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(8800947..8801011,8801115..8801185,8801260..8802588,8802835..8803724,8803945..8805186,8805251..8808505,8808596..8809066)
Genome map
AA seq 2440 aa AA seqDB search
MSIIRDQASSALDQYIREARNRNHAEDQRKRAARQVRDLVNIAKQEMGAEQFQRFFDTVN
QKTMALIQGADTYDKMAGVYILDALVDFDGIEPALKYSRFQQYIGTILRGKDLNPIQPAA
VVLGKLCKPGGSLISELVDAEVHTALEWLQSDRVEERRYSATLVLRELARNAPTLMYPYV
GFVFDHIWIGLRDPRHLIRTTSSETVSACFRIIRERDQEMKQEWMDKMFTEAVKGLKTNT
VENIHASLLVINELLEQGGMYMQGHYQEACEIVFRHRDARDPAIRKTVVSLIPHLANYAP
TEFSATYLHKFMVYLSGMLKKEKERNDAFLAIGDIANSVKSSIAPYLDGVLIHVREGLSV
QSRKRGSVDPVFGCISRLAVAVGQTLSKYMEALLDPIFACELTPQLTQALVDMAFYIPPV
KPTIQERLLNMLSKVLCGEPFRPLGAPHATAISAIPPIPRDPRDSSVHERGKAEVKLALN
TLGSFDFSGHVLNEFVRDVAIKYVEDDDPEIREAAALTCCQLYVRDPIVNQTSYHALQVV
ADVVEKLLTVGVSDPESKIRRTVLAALDERFDQHLAKAENIRTLFFALHDEQFAVREVAV
SIIGRLARHNPAYVIPQLRKTIIQMLTELEYTDVPRSKEESSKLLSLLTQHAQDLVKPYV
SSITEVLLPKASDPTPSVAATILQAIGELCTVGGAEMLAYKDSLMPIIIDALQDQSAPIK
REAALHTLGQLASNAGYVIKPYLEYPQLLEILQSIIRGEPQHGPLRQETIKLMGILGALD
PYKYQQVEERTPQTQRRPEATQQTDVSLMMGGLTPSQEDYYPTVAINALLQILKDQSLLQ
WHGNVVDAIMSIFITLGLKCVQFLDRVVPAFIAVIRASSPARLDYYFNHLGRLVSIVRQH
IRVYLPDIIAVLQDFWNTTSSLQTTILTLIESIARSLEGEFKVYLAGLLPLMLGALEKDT
STKRQPTEKIFHAFLVFGSSAEEYMHLIIPVLVRLFDNPAQPMFLRKSAIETIGKLSSMV
NLNDYASKIIHALTRVLASQEPSLRVAALDTLCALMLQLGRDYLHFEHTVEKAIVTYGIQ
HSNYDKAVEKLKKGEALPQNLAPRFEDNAVEPYPSENNPPRKLDLNPVHLRQAWETKGKA
TKDDWHEWFRKLSTTLLTESPNHSLRACASLASNYQPLARELFNSAFVSCWSELYDSYQE
ELITNIENTIKSENVPPDLLGQLLNLAEFMEHDDKALPIDIRVLGREAARCHAYAKALHY
KELEFLQDHNSHAVEALIVINNQLQQSDAAIGILRKVKAYKEGIQLRESWFEKLERWDEA
LNFYCQRERELPEDQPTPVDIVMGKMRCYHALGEWDSLAALAGKTWANSGPEIQRRIAAL
ATTAAWGLGKWDSMDIYLQSMKRFSPDRAFFGAILALHRNQFREALGFIQQAREGLDTEL
SALVSESYNRAYQVVVRVQMLAELEELIVYKQSGPEKRATLRATWETRLKGCQRNVEVWQ
RTLRLRSLVLTPQENMHMWTKFANLCRKSGRMGLAEKSLKHLINTDAPLESVIPYWFEQP
TSPGLERIASPIVYAVLKFQWEMGQQPGVRNSDRGIAERTLYCLKRFTEETARRVEGARL
QLNASAQAVNSIGDGLNHARYADFDEGAVLGAEAQRHWLEQTVLLAKCYLRQGDWIMTLH
KDDWQHTRRQEILDCYSKATHYHPRWYKAWHAWALANFEVVQALAPKREVEGRPEHSSIL
TRHVVPAVHGFFESIALSSGSSLQDTLRLLTLWLTYGGHQEVIAAVTDGFARVSIDTWLE
VIPQLIARINQPNRRVQASIHALLSDVGRAHPQALVYPLTVAMKSRQSTRRSKTASLIME
SMRQHSPKLVEQADLVSRELIRVAVLWHELWQEGLEEASRLYFGDHNIQGMFDVLEPLHD
MLEKGPVTLREISFTQTFGRDLSEAREWCRQYRHSQDVNDLNQAWDLYYQVFRRISRQLP
QMTSLELTYCSPELLQARDLDLAVPGTYRSGEEIVRIMGFDGTLSVINSKQHPRKLNIFG
SDGKTYAFLLKGHEDMRQDERVMQLFGLCNTLLANDSECYKRHLSIQRFPAIPLPQNSGL
LGWVPNSDTIHHLIKEYRESRKILLNIEHRIMLQMAPDYDNLTLMQKVEVFGYALDNTTG
QDLYRVLWLKSKSSEAWLDRRTNYTRSLGVMSMVGYILGLGDRHPSNLMLDRITGKIIHI
DFGDCFEVAMKREKYPERVPFRLTRMLTYAMEVSNIEGSFRTTCEHVMRVLRDNKESVMA
VLEAFIHDPLLTWRLTNPASPPGPHFISEREQAIAGPHAARARRPSILDGPIAPTEFLAA
QGAGVDNMTGAPPGARTRARTNSSAAPPGSMANGNGANEMAEVQNARAVEVLDRVSQKLT
GRDFKPDEELVVAEQVNKLIIEATKLENLCQHYIGWCSFW
NT seq 7323 nt NT seq  +upstreamnt  +downstreamnt
atgtcgataattagggaccaagcatccagtgcgctggaccagtatatcagagaagccagg
aaccggaaccatgcggaagatcaacgaaagcgcgctgcgcgccaggtccgagacctggtc
aatatcgcgaagcaagagatgggtgccgagcagttccaacgcttcttcgacaccgtcaat
caaaagaccatggccttgatccagggtgcggacacatatgacaagatggccggcgtctac
atcctcgatgcgctggttgatttcgacggcatagagcccgcgctgaagtacagccgcttt
caacaatacattgggactatcctgcggggaaaggacctcaaccccatacagcctgctgcg
gtggtccttgggaagctgtgcaagccgggagggtctctgatctcggagcttgtggatgcc
gaggtacacacagcgctcgagtggctgcagtccgatcgtgtcgaggagcgtcgatacagt
gccaccctggtacttcgcgaattggcgaggaatgcgcccactctgatgtacccctacgtg
gggttcgttttcgaccatatctggatcggactgcgggatcctcgacacttgatccggacc
acgtcgagcgagaccgtcagtgcttgcttcaggattatccgggagcgcgaccaagagatg
aagcaggaatggatggacaagatgtttacagaggcggtcaagggcctcaagacgaacact
gtcgaaaacatccatgcctcgctgctggtcatcaatgaacttctcgagcagggcggcatg
tacatgcaaggccactaccaggaagcctgcgagatcgtgttccgccacagggatgcgcgc
gatccagccatccgcaaaaccgttgtctccctcatcccccacctagccaactacgccccg
accgaatttagtgcgacctacctgcacaagttcatggtctacctctcaggcatgctcaaa
aaggagaaagagcggaacgacgccttcctcgccattggcgacattgccaactcggtcaag
agttccatcgcaccctatctcgacggtgtcttgatccatgtccgcgaagggctcagcgtg
caatctcgaaagcgcggctctgtcgatccggtgtttggctgcatcagccggctcgccgtg
gcggtcggccaaacgctgagcaaatatatggaggcccttctagatcccatcttcgcctgc
gagctcactccccagctgacccaagctctggtcgacatggctttctacattcctcccgtc
aaacccacaatccaggagcgacttctcaacatgctgagcaaggttctgtgtggtgagccc
ttccggccgcttggagcaccacatgcaacagcgatatcggccattccacctattcctcga
gatcctagggactcttcagtgcacgagcgaggcaaggctgaggtgaagctcgcattaaat
acactgggcagctttgacttctcaggccacgtgctgaacgagttcgtccgtgatgtcgcc
atcaaatacgtcgaggacgacgatcctgagatccgcgaggccgccgccctcacgtgctgt
cagctctacgtccgcgatcccattgtcaaccagacgagctatcacgccctccaagtcgtt
gccgatgttgtcgagaagctgttgacagtaggagtctcggaccctgagtccaagattcga
cggacagtgctcgctgcgctcgacgagcgattcgatcagcatttggccaaggccgagaac
attcgaaccctgttcttcgcccttcatgatgagcagtttgccgtcagggaagtggccgtg
tccatcatcggccggctggcccgtcataaccctgcttacgtcataccccagctgcgcaag
acaatcatacagatgttgaccgagctagagtacactgacgtgccgaggagcaaggaggag
agctcaaagctgctcagcctccttacacagcatgcccaggatttggtcaagccctatgtc
agctccatcaccgaagtgctcctccccaaggcttccgacccgaccccttcggtagctgcg
accatcctgcaggcgattggcgagctctgcacagttggcggcgcggagatgctcgcttac
aaggacagcctcatgcctatcatcattgacgccttacaggaccagagcgcccccatcaaa
cgggaagcggcactccataccctcgggcaactggcgagcaacgccggctacgtcatcaaa
ccttacctcgaatatccacagctactggagatcctacagtccatcattagaggcgagcct
caacacgggccgctacgccaagagacgatcaagctcatgggtatcctgggtgcactcgac
ccttacaagtatcagcaggtcgaagaacgaaccccgcaaacgcaacggcgccccgaggcg
acccagcagaccgatgtgtccctcatgatgggaggtctgaccccttctcaggaagactat
taccctacggtcgccatcaacgccctgctccagattctcaaggatcagtccttgctgcag
tggcatgggaatgtggtggatgccatcatgagcatcttcattaccttgggactgaagtgc
gtccagttccttgatcgggtcgtgcccgctttcattgctgttatcagggcatccagccca
gcccggctcgactactacttcaatcacttgggcaggcttgttagcatcgttcgtcagcac
atccgcgtctacctgccggatatcatcgccgtcctgcaggacttctggaacaccacctcc
tcgttgcagacgaccatcctgaccctcatcgagtctatcgcccgctctttggagggcgag
ttcaaggtctacctcgcgggtctgctcccgttgatgcttggagccctggaaaaggacacg
agcacaaaacgacagcccacagagaaaatatttcacgcctttctagtcttcggttccagc
gcagaagaatacatgcacctcatcatccccgttctcgtgcgcctgtttgacaaccctgcg
cagcccatgttcttgcggaagtcggccatcgagacgattggaaaactgtccagcatggtg
aacctgaatgactatgcctccaagatcatccacgccctgactcgggtcctcgccagtcag
gaacccagtctcagggtggccgcgctcgacaccctctgtgcgctcatgctgcagctgggc
cgggactatctgcacttcgagcatactgttgaaaaggccatcgtcacgtacggcattcag
cattccaattacgacaaggctgttgagaagctcaagaaaggagaggcgctgccgcagaac
ctcgccccccggtttgaggacaacgctgtggagccctacccgtccgagaacaacccgcca
aggaagctggatctgaacccggtgcatctgcgacaggcgtgggagacaaaaggcaaagcg
actaaggacgactggcatgagtggttccgcaaactcagcacgacgctgctgacagaatcg
ccgaaccactcccttcgagcctgcgccagcctggcgagcaattatcagcctctcgcgagg
gagctcttcaattccgcgtttgtttcttgctggagcgagctgtacgactcctaccaggaa
gagctgatcacgaacattgagaacacgatcaagtccgaaaatgtccctcctgacctcttg
ggccagttgctcaatcttgcagagttcatggagcacgatgacaaggcgcttccgattgac
atccgtgtcctgggccgcgaggccgcacgatgccatgcatacgctaaggccctccactat
aaggagcttgaattcctacaggatcacaacagtcacgcggtcgaggccctcatcgtgatc
aacaaccagctgcagcagtcggatgccgccattgggatcctgcggaaggtcaaggcttac
aaagaagggatccaactgcgggagagctggtttgagaaactggagcgctgggatgaagcg
ctcaacttctactgccagagggaacgggagctgcccgaggatcagcccacgccggtcgac
atcgtcatgggcaagatgcgttgctaccatgcattgggcgagtgggattcgttggcggcc
ttggctggcaagacctgggcaaactctggcccggaaatccagcggaggatcgcggccttg
gcgaccacggcagcatggggtcttggaaagtgggactcgatggacatctacctgcagtcg
atgaagcgcttctcgcccgaccgcgccttcttcggcgccattctcgccctgcatcggaac
cagttccgggaagccctaggtttcatccaacaagcccgagaaggcctcgacaccgagctc
agcgccctggtcagcgagtcatacaaccgcgcctaccaggttgtcgtgagggttcagatg
ctcgccgagctagaggagctcatagtctacaaacaaagtggcccggagaagcgtgccacc
ttgcgagcgacttgggagacccgcctgaaaggctgccagcgcaatgtcgaggtttggcag
cggacgctccggctgaggtctcttgttctcactccgcaagagaacatgcacatgtggacg
aaatttgccaacttgtgtcgcaagtctgggcggatgggactggcggagaagtctctgaag
cacctcataaacaccgatgcgccactggagtccgtcataccttactggttcgagcagcca
acaagtccgggtctcgaacgtatcgcatcccccatagtctacgctgtgctcaagttccag
tgggaaatgggtcagcagccgggcgttcggaattcggaccgcggaattgcagagcggaca
ctctactgccttaagaggttcaccgaggagaccgcccgccgagtggaaggcgcgaggttg
cagctgaacgcatctgcgcaggctgtaaacagcatcggggacgggctcaaccacgccagg
tacgccgacttcgacgaaggggcggtcttgggtgcggaggcgcaaaggcactggcttgaa
caaacggtgctactcgcaaagtgctatctccgacaaggcgactggatcatgacgctgcac
aaagacgactggcaacacactcggcgccaggaaatccttgactgttattccaaagcgacg
cactaccaccctcgatggtacaaggcctggcatgcttgggctctcgcgaactttgaggtg
gttcaggcactggcgcccaagagggaggtggagggacgaccggagcatagcagcatccta
acgcgccacgttgtcccggccgtgcatggctttttcgagtcgatcgcgctctcgtccggt
agttctttgcaggacacgcttcgcctcctaaccttgtggctcacctacggtggtcatcaa
gaggtcatcgccgccgtcacggatggcttcgcccgtgtcagcatcgatacctggctcgag
gtcataccccagctcattgcccgcatcaaccagcccaacaggcgggtgcaggcgtcgatc
cacgctttgttgtccgacgtcgggcgcgcacacccacaagcgctcgtctatccattgacg
gtggcaatgaagtcgcggcaaagcacgcggcgatccaagacggctagtctaatcatggag
agcatgcgccaacacagtcccaaacttgtggagcaggccgaccttgtgagccgcgaactt
atcagagtcgcggtcctgtggcacgaactctggcaggaggggcttgaggaagcctcccgg
ctgtatttcggtgaccacaacatccagggcatgtttgacgtcctggaacccctccatgat
atgctcgagaagggcccggtgacgctcagagagatttctttcacccagacgttcggcagg
gatctgagcgaggcccgtgaatggtgccgccagtaccgccactctcaggatgtcaacgac
ctcaaccaggcatgggacctctactaccaagtgttccgccgcattagccgacagctgccc
cagatgacaagtcttgagctgacatactgctctcccgagctgcttcaagccagggatctt
gaccttgcggtgccgggaacgtaccgcagcggcgaggaaatcgtcaggatcatgggcttc
gatggtactttgagcgtaatcaactcaaagcagcaccccaggaagctcaacatcttcgga
agtgacggtaaaacttacgcattcttgttgaagggccacgaggatatgcgtcaagacgag
cgcgtcatgcagctctttggcctttgcaacaccctcctggctaacgattccgagtgctac
aagcggcatctaagcattcaacgattcccagcgatcccgctgccgcagaactcgggcttg
ctcggctgggtgcccaacagcgatacaatccaccacctcatcaaggagtacagggagtcc
agaaagatcctccttaacatcgagcaccggatcatgctccagatggctccggactacgac
aatttgaccctgatgcaaaaggtcgaggtgtttggctatgccctggacaacacgacgggc
caagacctgtaccgcgttctctggctcaagagcaagagttcagaggcgtggctggacagg
cggacgaattacacgcgctccctcggcgtcatgtccatggtcggatacatcctaggtcta
ggcgacaggcaccctagtaatctgatgctcgatcggattacaggcaagatcatccacatc
gacttcggcgactgcttcgaggtggcgatgaagcgagagaaatatccggaacgggtgccc
ttcagactcaccaggatgcttacctacgccatggaggttagcaacatcgaaggcagtttc
cgcacaacgtgcgagcatgtgatgagagtcctgcgtgacaacaaggagagcgttatggct
gtcctggaggcttttatacatgatccgctgctcacatggcgccttacaaaccctgccagc
ccgcccggcccccacttcatctcagaacgggaacaagcgattgctggccctcatgctgcg
cgggctcgccgaccctcaattcttgacgggcctattgcccctactgagttcctcgccgct
cagggtgcaggtgtcgataacatgacgggagcacccccgggagcccgcacccgcgcgcgc
accaattcctcggctgcgccacctggcagcatggccaatggcaacggagcaaacgagatg
gctgaggtgcagaacgcgagggcagttgaggtcctcgaccgcgtttcgcagaaactcact
gggcgagacttcaaaccagacgaagagcttgtcgtagctgagcaagttaacaagctcatc
atcgaagccaccaagctcgagaacctctgccagcattacataggatggtgcagcttttgg
tga

DBGET integrated database retrieval system