KEGG   Thielavia terrestris: THITE_2111115Help
Entry
THITE_2111115     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
ttt  Thielavia terrestris
Brite
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     THITE_2111115
Peptidases [BR:ttt01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   THITE_2111115
Exosome [BR:ttt04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   THITE_2111115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(9914711..9914738,9914810..9914877,9914929..9917048,9917102..9917240)
Genome map
AA seq 784 aa AA seqDB search
MACPHIGAANLSKPTPADSVYREDCTQCFDSIDDPDGLDVCLKCFNGGCAGNRNHARLHS
NTRKHPLVLNIRRARKRVVRDEPPLKMSKLAIAAETEADKYDTTLAVKCLECGIDDIDKT
DPAIAPVVDAVMKAHTFSRKEEVKAWEQELTSCEHILTLQQGPPRKIESQNLGHCSKCDL
KENLWLCLECGNLGCGRAQFGGVGGNSHALAHSTESNHGVAVKLGSITPEGNADVYCYKC
DEERIDEDLGSHLANWGIILSERQKTEKSLTEMQIEQNLRWEFSMTTEDGKELTPLFGPG
LTGLKNLGNSCYLASILQCLYDMPSFQQRYGGLLSTSDASDPAQDLETQLRKIGDGLLSG
RYSKPDSDVITSELSPEIPHQKGLQPSMLKHLMGRGHPEFSTMRQQDAFELLQHLIKLIT
RSKHPAELGDPTQAMRFVMEQRLQCLGCNKVRYSSTEQDSIFIDVPLEKLPAEEGQKPEY
KPVHFKQCLDNLTAPETVELTCASCGSKQGFLKRTLFKTFPDVLVVNARKMTLENWVPIK
VDVPVLIGDEPFALDSYLSKGLQPDEELLPEEAAAASNVPAFVPNQEALVMLQEMGFPQV
RCEKALHATGNSDANAAMEWLFAHMDDPDIDAPLNLGGGAAEKPAAAVDPEKLAQLEAMG
LGGPRAVKALKETGGDVDRAVEWLFSHPDDQGDFGEEDATSSGQSEGVGKKGEAGSSALP
ANFQLQSIVCHKGTSIHAGHYVAFIRKKLGEEVSWVLFNDEKVVKAGNADEMKQFAYIYF
FKRV
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgcccccatattggagcagctaatctctcgaagccgactcctgccgattcggtt
tatcgcgaagactgcactcagtgctttgactccattgacgacccagatggcctggatgtc
tgccttaagtgcttcaacggcggctgcgccggcaaccgcaaccatgccaggctgcacagc
aacactcggaagcaccccctcgttctcaatatccgccgtgcccgaaaacgcgtcgtccga
gacgagcctcccctgaaaatgtcgaagcttgccattgccgccgagaccgaggccgacaag
tatgacacgacgctggctgtcaagtgcctcgagtgcgggatcgacgacattgacaagacc
gacccagcgattgcgccagttgtggatgccgttatgaaggcacacacgttttcgcggaaa
gaggaggtcaaggcgtgggagcaggagttgaccagctgcgagcacattctcacgttgcag
caggggccgccccggaagatcgagtcacagaacttggggcactgctccaagtgcgatctg
aaggaaaacctctggctttgcctggagtgcggcaacctcggctgcggaagggcgcagttt
ggtggtgtgggcgggaattcgcatgctctggcgcactcaacagagtccaaccacggcgtg
gctgtgaaactcggctcgattacgcccgagggcaacgcggatgtgtactgctacaaatgc
gacgaggaacggatcgacgaggacctcggttctcacctggccaattggggcatcatccta
tcagagcggcagaagacggaaaagagcttgaccgagatgcagatcgagcaaaacttgcgc
tgggagttttcgatgacgactgaagacggcaaggagctgaccccgctcttcggccctggc
ctgacgggtctcaagaacctcggaaacagctgctatctggccagcattctgcagtgcctc
tacgacatgccgtccttccagcaacggtacggtggccttctgtcgacttctgacgcgtca
gaccctgcgcaagacctggagacccaacttcggaagattggggatggtttactttctgga
cgctactctaagcccgactcggatgtcattacctcggagctttcgccagagattccacat
cagaaggggcttcagccatcgatgctcaagcacttgatgggacgcggtcacccggagttc
tcaaccatgcgccaacaagacgcctttgagctcctccagcatctcatcaagctcatcacg
cgatcgaagcaccccgcagagctcggcgatcccacccaggcgatgcgctttgtcatggag
cagcgcctgcagtgcctgggatgcaacaaggtccgctacagcagcaccgagcaggacagc
atattcatcgacgtcccgctcgaaaagctcccggccgaggagggccagaagcccgagtac
aagccggtccatttcaagcagtgcttggacaacctgacggcgccggagaccgtcgagctg
acttgcgcgtcgtgcggcagcaagcaagggttcctgaagcgcacgctcttcaagacgttc
cccgatgtcctcgtcgtcaacgcccgcaaaatgacgctcgagaactgggtccccatcaag
gtcgacgttcccgtcctgatcggcgacgaaccattcgcgctggactcgtacctctccaag
ggcctacagcccgatgaggagctcttgccagaggaggccgccgccgcgagcaacgtaccc
gcctttgtgcctaaccaggaagccctcgtgatgctccaagagatgggcttcccgcaggtc
cggtgcgagaaggcgctgcacgcgaccggcaacagcgatgcgaacgcggctatggagtgg
ctgtttgcccacatggacgatccggacatcgatgcgcctctcaacctcggcggcggcgcg
gccgaaaagccggccgccgcggtcgaccccgagaagctcgcgcagctggaggcgatgggc
ctcggcgggccgagggcggtcaaggctctcaaggagacgggcggggacgtcgacagggcg
gtcgagtggctgtttagccaccccgatgaccagggtgactttggggaggaggatgcgaca
agcagcgggcaaagcgagggggtgggcaaaaaaggagaggcgggaagcagcgcgctgccg
gcgaacttccagctgcaatccatcgtctgccacaagggcaccagcatccatgcgggacac
tacgtcgcgttcatccgcaagaagctcggcgaggaagtttcctgggtcctgttcaacgac
gagaaggttgtcaaggctgggaatgcggacgaaatgaagcagttcgcctacatctacttc
ttcaagcgggtttag

DBGET integrated database retrieval system