KEGG   Thielavia terrestris: THITE_2111115Help
Entry
THITE_2111115     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
ttt  Thielavia terrestris
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:join(9914711..9914738,9914810..9914877,9914929..9917048,9917102..9917240)
Genome map
AA seq 784 aa AA seqDB search
MACPHIGAANLSKPTPADSVYREDCTQCFDSIDDPDGLDVCLKCFNGGCAGNRNHARLHS
NTRKHPLVLNIRRARKRVVRDEPPLKMSKLAIAAETEADKYDTTLAVKCLECGIDDIDKT
DPAIAPVVDAVMKAHTFSRKEEVKAWEQELTSCEHILTLQQGPPRKIESQNLGHCSKCDL
KENLWLCLECGNLGCGRAQFGGVGGNSHALAHSTESNHGVAVKLGSITPEGNADVYCYKC
DEERIDEDLGSHLANWGIILSERQKTEKSLTEMQIEQNLRWEFSMTTEDGKELTPLFGPG
LTGLKNLGNSCYLASILQCLYDMPSFQQRYGGLLSTSDASDPAQDLETQLRKIGDGLLSG
RYSKPDSDVITSELSPEIPHQKGLQPSMLKHLMGRGHPEFSTMRQQDAFELLQHLIKLIT
RSKHPAELGDPTQAMRFVMEQRLQCLGCNKVRYSSTEQDSIFIDVPLEKLPAEEGQKPEY
KPVHFKQCLDNLTAPETVELTCASCGSKQGFLKRTLFKTFPDVLVVNARKMTLENWVPIK
VDVPVLIGDEPFALDSYLSKGLQPDEELLPEEAAAASNVPAFVPNQEALVMLQEMGFPQV
RCEKALHATGNSDANAAMEWLFAHMDDPDIDAPLNLGGGAAEKPAAAVDPEKLAQLEAMG
LGGPRAVKALKETGGDVDRAVEWLFSHPDDQGDFGEEDATSSGQSEGVGKKGEAGSSALP
ANFQLQSIVCHKGTSIHAGHYVAFIRKKLGEEVSWVLFNDEKVVKAGNADEMKQFAYIYF
FKRV
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgcccccatattggagcagctaatctctcgaagccgactcctgccgattcggtt
tatcgcgaagactgcactcagtgctttgactccattgacgacccagatggcctggatgtc
tgccttaagtgcttcaacggcggctgcgccggcaaccgcaaccatgccaggctgcacagc
aacactcggaagcaccccctcgttctcaatatccgccgtgcccgaaaacgcgtcgtccga
gacgagcctcccctgaaaatgtcgaagcttgccattgccgccgagaccgaggccgacaag
tatgacacgacgctggctgtcaagtgcctcgagtgcgggatcgacgacattgacaagacc
gacccagcgattgcgccagttgtggatgccgttatgaaggcacacacgttttcgcggaaa
gaggaggtcaaggcgtgggagcaggagttgaccagctgcgagcacattctcacgttgcag
caggggccgccccggaagatcgagtcacagaacttggggcactgctccaagtgcgatctg
aaggaaaacctctggctttgcctggagtgcggcaacctcggctgcggaagggcgcagttt
ggtggtgtgggcgggaattcgcatgctctggcgcactcaacagagtccaaccacggcgtg
gctgtgaaactcggctcgattacgcccgagggcaacgcggatgtgtactgctacaaatgc
gacgaggaacggatcgacgaggacctcggttctcacctggccaattggggcatcatccta
tcagagcggcagaagacggaaaagagcttgaccgagatgcagatcgagcaaaacttgcgc
tgggagttttcgatgacgactgaagacggcaaggagctgaccccgctcttcggccctggc
ctgacgggtctcaagaacctcggaaacagctgctatctggccagcattctgcagtgcctc
tacgacatgccgtccttccagcaacggtacggtggccttctgtcgacttctgacgcgtca
gaccctgcgcaagacctggagacccaacttcggaagattggggatggtttactttctgga
cgctactctaagcccgactcggatgtcattacctcggagctttcgccagagattccacat
cagaaggggcttcagccatcgatgctcaagcacttgatgggacgcggtcacccggagttc
tcaaccatgcgccaacaagacgcctttgagctcctccagcatctcatcaagctcatcacg
cgatcgaagcaccccgcagagctcggcgatcccacccaggcgatgcgctttgtcatggag
cagcgcctgcagtgcctgggatgcaacaaggtccgctacagcagcaccgagcaggacagc
atattcatcgacgtcccgctcgaaaagctcccggccgaggagggccagaagcccgagtac
aagccggtccatttcaagcagtgcttggacaacctgacggcgccggagaccgtcgagctg
acttgcgcgtcgtgcggcagcaagcaagggttcctgaagcgcacgctcttcaagacgttc
cccgatgtcctcgtcgtcaacgcccgcaaaatgacgctcgagaactgggtccccatcaag
gtcgacgttcccgtcctgatcggcgacgaaccattcgcgctggactcgtacctctccaag
ggcctacagcccgatgaggagctcttgccagaggaggccgccgccgcgagcaacgtaccc
gcctttgtgcctaaccaggaagccctcgtgatgctccaagagatgggcttcccgcaggtc
cggtgcgagaaggcgctgcacgcgaccggcaacagcgatgcgaacgcggctatggagtgg
ctgtttgcccacatggacgatccggacatcgatgcgcctctcaacctcggcggcggcgcg
gccgaaaagccggccgccgcggtcgaccccgagaagctcgcgcagctggaggcgatgggc
ctcggcgggccgagggcggtcaaggctctcaaggagacgggcggggacgtcgacagggcg
gtcgagtggctgtttagccaccccgatgaccagggtgactttggggaggaggatgcgaca
agcagcgggcaaagcgagggggtgggcaaaaaaggagaggcgggaagcagcgcgctgccg
gcgaacttccagctgcaatccatcgtctgccacaagggcaccagcatccatgcgggacac
tacgtcgcgttcatccgcaagaagctcggcgaggaagtttcctgggtcctgttcaacgac
gagaaggttgtcaaggctgggaatgcggacgaaatgaagcagttcgcctacatctacttc
ttcaagcgggtttag

DBGET integrated database retrieval system