KEGG   Thielavia terrestris: THITE_2111280Help
Entry
THITE_2111280     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
  KO
K04709  Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
ttt  Thielavia terrestris
Pathway
ttt00600  Sphingolipid metabolism
ttt01100  Metabolic pathways
Module
ttt_M00094  Ceramide biosynthesis
ttt_M00099  Sphingosine biosynthesis
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    THITE_2111280
Enzymes [BR:ttt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     THITE_2111280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TRAM_LAG1_CLN8 TRAM1
Motif
Other DBs
NCBI-GeneID: 11518915
NCBI-ProteinID: XP_003651237
JGI: Thite2_2111280
UniProt: G2R1S4
Position
2:join(329865..330072,330137..330447,330513..330800,330885..331502)
Genome map
AA seq 474 aa AA seqDB search
MSSPPATTASHDGTAKSSSLPPRRTGKPQHINGPLYRQANSNVVLIRRPKRKNEGPMKQL
ARWFVDNQIGLSFNLLALLFLAHGMPRARDYTAKYFTLSYYNPSTGKYGLGWADGHFILF
CVVVLTGLRAATMENILAPLAKSQGMSKRKDITRFSEQAWMVLYYSVFWPLGLYVYRQSP
AYLDLRELWTGWPDREVTALVKGYFLAQLAFWLQQLIVINIEERRKDHWQMFTHHVITSS
LMYAAYRYGHTRVGNLILVLMDVSDLALGLAKCLKYLGHQTMCDIMFGVFMFSWLIARHV
LYLCVCYSVWAHTPEIMPTGCFKSAQGSLTGPLEPPTDKGLRYLLEPLWDSEGLFCYNDS
VKWAFLAMLLFLQVLTLIWFTMIIRVAIKVLNGSSAEDVRSDDEAGEDDDEDEFVYEEAQ
PLEQEVGVEEIDLKHWERRTGIKRQTSVTTGVSLPGHSDRKELLGRIGCEKQVE
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccctcccgccacgaccgcaagccatgacggcacggcaaaatcctcctccctc
ccgccccggcggaccggcaagccccagcacattaacgggccgctgtacaggcaggcgaac
agcaatgtcgtgctgattcgccgccctaagaggaaaaacgaggggcccatgaagcagctc
gcccggtggttcgtcgacaaccagattggcctgtcattcaacctcctcgccctgctcttc
ctcgcccacggcatgccccgcgccagggactacacggccaagtacttcacgctttcgtac
tacaacccgagcaccgggaagtacgggctgggctgggccgacggccacttcatcctgttt
tgcgtcgtcgttctgaccggcctgcgcgccgccaccatggagaacatcctcgcgcctctc
gccaagtcccagggcatgtccaagcggaaggacattaccaggtttagtgaacaggcctgg
atggtgctgtactacagcgtgttctggccccttggtttgtacgtctaccgccagtcgcca
gcctacctggacctccgtgagctgtggaccggctggccagaccgtgaggttaccgcgctc
gtaaagggctatttcctcgcgcagctagccttttggctccagcaacttatcgtcatcaac
attgaggagcgcaggaaggaccattggcaaatgttcacccaccacgtcatcacgagctcc
ctcatgtatgccgcataccgatacgggcatacacgggtaggcaatctcatcctggtcctg
atggatgtgtcggacctggccctcgggttggccaagtgtctcaaatacctcggccaccag
accatgtgcgacatcatgttcggtgtcttcatgttctcatggctaatcgcacggcacgtc
ctgtacctctgcgtgtgctactccgtctgggcccacacccccgagatcatgccgactggc
tgctttaagagcgctcagggcagtctcaccggaccgttggagcccccaaccgacaagggc
ctgcggtacctcctggagcctctctgggattcggagggcttgttctgctacaacgactcg
gtcaagtgggccttcctcgccatgctgctcttcttgcaggtcctcaccctgatctggttc
accatgatcatccgcgtcgccatcaaggtcctgaacggctcttctgccgaggacgtgcgg
agcgacgatgaggcgggcgaggacgacgacgaggacgagttcgtctacgaggaggcgcag
ccgctcgagcaggaggtcggcgtcgaggagattgacctgaagcactgggagcggcggacg
ggcattaagaggcagacgtcggtcactacgggtgtcagtctgccgggccacagcgaccgc
aaggagctcctcggccgcatcgggtgtgagaagcaggtcgagtga

DBGET integrated database retrieval system