KEGG   Thielavia terrestris: THITE_2111431Help
Entry
THITE_2111431     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
ttt  Thielavia terrestris
Brite
Enzymes [BR:ttt01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     THITE_2111431
Peptidases [BR:ttt01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   THITE_2111431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:join(671751..671766,671840..673512)
Genome map
AA seq 562 aa AA seqDB search
MATVNVVIKHQGKKYDVEVDTSATGELLKYQLFSLTGVEPERQKILIKGGQLKDDTDLSK
LGLKPGQVIMMMGTPGEGGGQIVRPTEKIKFLEDMTEAEAAQQAGAIPAGLVNLGNTCYL
NSTLQALRSIPELQDALAKHKHTSMSEIPQLDITNQLKDLFKDMSETQGGMSPFTFLNAL
RVTYPQFAERSKKGPGYAQQDAEEAWSQIVSQLRQKLRGPEPAEGDTARAGSFVDKYMAG
EFSSTLECNEPEAREGGEQPTSAKETFLKLNCHIDSQTAHLRDGLVSGLTEKIEKRSEVL
GRDATYTKTSRISRLPKYLTVHFVRFFWKRDVQKKAKIMRKVTFPHELDAVEFCTDELKK
ALIPVRDKVREVRKDEEDIERARKRRKKNHMLDGEVPGEKKEGAKKDDKKDDKKDDKKPA
KSADGDVEMAETFKTEAEWEAEKEAALLESKKELNALIDPDLRKDEGANHSGLYELRAVV
THQGASADSGHYTAYVKKTGPKDPVTGKIGEEDGKWWWFNDDKVTEVTSDKIDALAGGGE
SHSALILLYKAIPLPTAEGVME
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgtcaacgtggtaataaagcaccaaggcaaaaagtacgacgtcgaggttgac
acgtctgcgactggcgagcttctcaagtatcaactgttcagtctcaccggcgtcgagcct
gagcggcagaagattctaatcaagggcggtcaactcaaggatgacaccgacctgagcaag
ctcgggctgaagcccggccaggtcatcatgatgatgggtacgccaggcgagggcgggggc
cagatcgtgcggccgaccgagaagatcaagttcctcgaagacatgaccgaggccgaggcc
gcgcagcaggccggagccatccccgctggcctggtcaatctcggcaacacctgctacctc
aactcgacgctacaggctctgcgctccattcctgagctccaggatgctcttgcgaagcac
aaacacacgtccatgtcggaaattcctcagctggacatcacgaaccagctcaaggacctc
ttcaaggacatgtcagagacacaaggcggcatgtcgccgttcacgtttctgaatgctctg
cgggtgacctatccccagttcgccgagcgctcgaagaaagggccgggctacgcccagcag
gatgccgaggaggcgtggtcccagatcgtttcgcagctgagacaaaagcttcgggggcct
gaaccggccgaaggcgacaccgccagggccgggtccttcgtggacaaatacatggctggg
gagttctccagcacgcttgaatgcaacgagcccgaggcccgcgagggtggcgagcaacca
acctcagccaaggagacgtttctcaagctcaactgccacatcgatagtcagactgctcac
ttgagggatggcctcgtgagcggcctaacggagaagatcgagaagcgatcggaggtgttg
ggcagggatgccacgtacaccaagacgtccaggatctcgcggctaccaaagtatctcact
gtccactttgtgcgcttcttctggaagcgcgacgtccagaagaaggccaagatcatgcgc
aaggtgacgttcccgcacgagctggatgccgtcgagttctgcacggacgagctgaaaaag
gccctcatccctgtccgagacaaggtgcgcgaggtgcgcaaggatgaggaggacattgag
cgggctcgcaagcgccgaaagaagaaccacatgctggacggcgaagtaccgggcgagaag
aaggaaggcgccaagaaggacgacaagaaggacgacaagaaggacgacaagaagcccgcc
aagtcggcggacggcgacgttgagatggccgagacgttcaagacggaggccgagtgggag
gcggagaaggaggcggcgctcttggagtccaaaaaggagctgaacgccttgatcgatccg
gatctccggaaagacgagggcgccaaccactcgggcctctacgagctccgcgcggtcgtc
actcaccagggcgccagcgccgacagcggccactacacggcgtacgtcaaaaagacgggc
cccaaggatcccgtcaccggcaagatcggcgaggaggacggcaagtggtggtggttcaac
gacgataaagtgaccgaagtgacgtcggacaagatcgacgcgctggcgggcggcggcgag
tcgcactcggcgctcatcctcctctacaaggccattccccttcctaccgccgaaggtgtg
atggaataa

DBGET integrated database retrieval system