KEGG   Thielavia terrestris: THITE_2111691Help
Entry
THITE_2111691     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ttt  Thielavia terrestris
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    THITE_2111691
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    THITE_2111691
   00630 Glyoxylate and dicarboxylate metabolism
    THITE_2111691
Enzymes [BR:ttt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     THITE_2111691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(join(1021699..1021756,1021839..1022069,1022162..1022562,1022673..1023250,1023315..1023675))
Genome map
AA seq 542 aa AA seqDB search
MASYEAVLQGVNVLGPVQESQRKILTPQALAFLALLQRTFNPTRKALLERRKLRQAELDK
GALPDFLPETKHIREDPTWKGAPPAPGLVDRRVEITGPTDRKMVVNALNADVWTYMADFE
DSSAPTWDNMVNGQVNLYDAVRRQIDFKQGGKEYKLRTDRKLPTLIVRPRGWHLEEKHVT
VDGEPMSGSLFDFGLYFFHNAFETVKRGFGPYFYLPKMESHLEARLWNDVFNLAQDYIGM
PRGTIRGTVLIETILAAFEMEEIIYELRDHSSGLNCGRWDYIFSVIKKFRQNSNFVLPDR
SCVTMTVPFMDAYVKLLIQTCHKRGVHAMGGMAAQIPIKDDPAANEKAMEGVRADKLREV
RAGHDGTWVAHPALASIASDIFNKHMPTPNQLFVRREDVSIGANDLLNMNVPGQITEQGI
RKNLNIGLGYMEAWLRGVGCVPINHLMEDAATAEVSRSQLWQWVRHGVTTAEGKRVDKGY
ALKLLKEQAQELSAKAPKGNKYQLAAQYFSGQVTGEGYADFLTSLLYNEITSAGSPKPAS
KL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggccagctacgaggcggtcctgcagggcgtcaacgtcctcggccccgtccaggagtcc
cagcgcaagatcctgacgccccaggcgcttgccttccttgcgctgctgcagcgcaccttc
aacccgacccgcaaggccctccttgagcgccgcaagctccgccaggccgagctcgacaag
ggcgccctccccgatttcctgcccgagacaaagcacatccgcgaggacccgacatggaag
ggcgcgccgcccgctccggggctggtcgaccgccgtgtcgagatcacgggtcccacggac
cgcaagatggtggtgaatgcgctgaatgcggatgtctggacttacatggctgatttcgag
gactcgagcgcgccaacgtgggataacatggtcaacggccaggtgaacctctacgacgcc
gtgcggcgccagatcgatttcaagcaaggggggaaggagtacaagctgcggacagacagg
aagctgccgacgctcatcgtgcggccgcgtggctggcacctggaggagaagcacgtcacc
gtcgacggtgagcccatgagcggatccctcttcgactttggcctgtacttcttccacaac
gccttcgagacggtcaagcgcggcttcggcccctacttctacctgcccaagatggagtcg
cacctcgaggcgcgcctctggaacgacgtgttcaacctggcccaggactacatcggcatg
ccgcgcgggacgatccgcggcaccgtgctgatcgagaccatcctggccgccttcgagatg
gaggagatcatctacgagctgcgggaccacagctctggcctcaactgcggccgctgggac
tacatcttcagcgtcatcaagaagttccgccagaactccaatttcgtgcttcctgaccga
agctgtgttacgatgacggtgcccttcatggatgcatatgtcaagctgctcatccagacc
tgccacaagcgcggggtccatgccatgggcggcatggcggcgcagatccccatcaaggac
gacccggccgccaacgagaaggcgatggagggcgtccgggcggacaagctgcgcgaggtg
cgcgccgggcacgacggcacctgggtcgcccatcccgcgctggcgtccatcgcgtctgac
atcttcaataagcacatgcccacgccgaaccagctgtttgtgcgccgcgaggacgtctcc
atcggcgcgaacgacctcctcaacatgaacgtccccggccagatcaccgagcagggcatc
cgcaagaacctgaacatcggcctcgggtacatggaggcctggctgcggggcgttggctgc
gtgccgatcaaccacctgatggaggacgcggccacggccgaggtgtcgcgcagccagctc
tggcagtgggtgcgccatggggtcaccacggccgagggcaagcgcgtcgacaagggctac
gcgctcaagctgctcaaggagcaggcgcaggagctgtcggccaaggcgcccaagggcaac
aagtaccagctggcggcgcaatacttctcgggccaggtcacgggcgagggctatgctgat
ttcttgacttcgttgctttacaacgagatcacgtcggcagggagccccaagccggcctcc
aagttgtaa

DBGET integrated database retrieval system