KEGG   Thielavia terrestris: THITE_2112048Help
Entry
THITE_2112048     CDS       T02228                                 

Definition
(RefSeq) hypothetical protein
Organism
ttt  Thielavia terrestris
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(join(1522841..1523168,1523260..1523800,1523870..1523965,1524029..1524224))
Genome map
AA seq 386 aa AA seqDB search
MAATVAHSQHAPPPGLHPLQTAPVKAAGSGQEPTQEKNILDDKPFDIGAGRLSASDFVRV
RTLGTGTFARVCLVRPSHGTEADRSKVYALKILRKTEVIKQKQLDHVRHERQILADVRGH
PFITNFLASFADHDFLYFLLDYVPGGELFTYVRKFRRFDEDTARFYAAEIVLVLEHLHEE
QGGVAYRDLKPENLLLDAEGHIKLVDFGFAVRLGNNESGHPVETYTMCGTPEYIAPEVIH
NKGHTTAVDWWALGILIYEFLMGFPPFWHSNKMELFKQIVEKPVVFPSEPPVSAAAQDII
RQLCTVDRSRRLGNISGGAARVKEHPFFAAVDWDAVYHKRRPGPIIPPVRFPGDTQCFDV
WPEEDEHWDEYTDELAERYEACFSDF
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggcggccacagtcgcgcactcgcagcacgcaccaccgcccgggctgcaccccttacaa
acggcaccggtgaaagccgccggcagtgggcaggagccgacacaagagaagaatatcctc
gacgacaagccatttgacattggcgccgggaggctatcagcgagcgacttcgtccgggtg
cggacattagggacagggaccttcgcccgcgtctgtctcgtccggccgtcccacggcacc
gaggctgaccgcagcaaggtgtatgcgctcaagatcctccgcaaaaccgaggtgatcaag
cagaagcagctcgatcatgtgcgtcacgagcgccagatattggccgacgtacggggccac
ccctttatcaccaacttcctcgcgtccttcgccgatcacgactttctctatttcctcctc
gactacgtgcccggcggcgagctcttcacctacgtgcgcaagttccgccgcttcgacgag
gacacggcccgcttctacgccgccgagatcgtgctggtcctcgagcacctgcacgaggag
caaggcggcgtcgcctaccgggacctgaagcccgagaacctgctgctcgacgccgagggc
cacatcaagctggtcgactttggcttcgccgtgcggctcgggaataacgaatccggccac
cccgtcgagacctacaccatgtgcggcacccccgagtacatcgcgcccgaggtgatccat
aacaagggccacaccaccgcggtcgactggtgggcgctgggcatcctcatctacgagttc
ctgatgggcttcccgccgttttggcactccaacaagatggagctattcaaacaaatcgtc
gaaaaacccgtcgtctttccgagcgagccgcccgtcagcgccgccgcgcaggacatcatc
cggcagctgtgcaccgtcgaccgctcgcgccggctgggcaacatctcgggcggcgccgcc
cgcgtcaaggagcaccccttcttcgccgccgtcgactgggacgccgtctaccacaagcgc
cgcccgggccccatcatcccccccgtccgcttccccggcgacacccagtgcttcgacgtc
tggcccgaggaggacgagcactgggacgagtacaccgacgagctggcggagcggtatgag
gcgtgctttagcgatttttag

DBGET integrated database retrieval system