KEGG   Thielavia terrestris: THITE_2112126Help
Entry
THITE_2112126     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
ttt  Thielavia terrestris
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    THITE_2112126
Enzymes [BR:ttt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     THITE_2112126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(join(1671245..1672213,1672296..1673249))
Genome map
AA seq 640 aa AA seqDB search
MAALGLSSAPSASPRLGRKLRKRSSKTLARPASSDTEWYDGDVLVPSCDAFLDNSKTLAY
TGGQAASDSSVSASSRKEDNWLTFKNEIIRLAHTLRLKGWRRVPLDSGDSISVERLSGAL
TNAVYVVSPPSEALLPREPGKKQPTKVLLRIYGPQVEHLIDRENELGVLKRLARKKIGPR
LLGTFLNGRFEQYLNATALTPASMREPETSRQIAKRMRELHDGIELLEEERDQGPGVWKN
WDRWLSQVEKTVLYLDKQILSGAQTHRLPGGVWKTRGFVCGVQWPVFKALVDKYRKHLEA
YYGNAKNIRDKLVFAHSDTQYGNILRMRPDDQKSPLLQPANEHKQLVVIDFEYAAANLPG
LEFANHFSEWTYNYHDPVRPYACDHALYPTPDQQRSFVKAYVDHRPQLPYPDSNPSPSLS
VTPVRGEGPSGSSSSGGGGGGSGGGLLTNGGLSGEAAAAGAAGLRATPSSSSIGEFMLDA
RVPPGGWKEEERKREEEAERRVRELLEETRLWRTANSAQWVAWGIVQAKITAVEEEEADV
AALSEASDANAGVAGMGGDGGGVVDGAIGAEEEAERQQQQQQQQQQQQQQQQQEEAEEFD
YLAYAQDRAYFFLGDCVAMGLVTTEELGEEVSRRIKVVEY
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atggcggccttgggattgagttccgcgccgtcagccagtcctcgtcttggacggaagctc
cgcaagagatcgagcaaaactctcgcccgtccggcttcgtcagacaccgagtggtacgac
ggcgacgtgttagttccaagctgcgacgcttttctcgacaattccaagacgcttgcctac
actggcgggcaggccgcttcggacagttccgtttctgcatctagccgcaaggaagacaat
tggctcacgttcaaaaacgagataatccggctggcgcacacgttgcgcctcaagggctgg
aggcgcgtgccgctggatagcggcgacagcatctcggtcgagcgcttgagcggggccctg
accaacgccgtctacgtggtgtcacccccatcagaagccctgttgccccgcgaacccggc
aagaagcagccgaccaaggtgctgctgagaatatacgggccccaggtggagcatctaatc
gaccgagagaacgagctgggcgtgctcaagcggctggctaggaaaaagatcggcccccgg
ttactggggaccttcctcaacggccggttcgagcagtacttgaacgccaccgcgctgacg
ccggccagcatgcgggagccagagacatctaggcagatcgccaagcgcatgcgcgagctg
catgacggcatcgaactactcgaggaggagagggaccaggggcccggcgtatggaagaac
tgggacaggtggctgagtcaggtcgagaagacggttctgtacctcgataagcagatcctg
tctggggcgcagactcaccgcctgccaggcggcgtctggaaaacgcgaggttttgtttgc
ggcgtgcaatggccggtgttcaaggcccttgtagacaagtatcgcaagcacttggaagcg
tactacgggaacgccaagaacatccgcgacaagctcgtctttgcccacagcgatacccaa
tacggcaacatcctccgcatgcgaccggacgaccagaagtccccgctcctgcagccggcc
aacgagcacaagcagctcgtggtcatcgacttcgagtacgccgccgcgaacctgccgggc
ctcgagttcgccaaccacttctccgagtggacctacaactaccacgaccccgtccgcccc
tacgcctgcgaccacgcgctctacccgaccccggaccagcagcgcagcttcgtcaaggcc
tacgtcgaccaccgcccccagctgccctacccggactccaacccgtcgccgtcgctgtcc
gtgacgcccgtcaggggcgaggggccgtccggtagtagtagcagtggtggtggtggtggt
ggtagtggtggtggtcttctcacgaatggtgggctcagcggggaggcggcggcggccggg
gcggcggggctgcgcgcgacgccgtcgtcgagctcgatcggcgagttcatgctggacgcg
cgggtgccgccgggcgggtggaaggaggaggagcgcaagcgcgaggaggaggccgagcgg
cgcgtgcgcgagctgctcgaggagacccggctgtggcgcacggccaactcggcccagtgg
gtcgcctggggcatcgtgcaggccaagatcaccgcggtggaggaagaagaggccgacgtt
gctgctctttcggaggcgtctgatgccaacgctggtgtagccggtatgggcggtgatggt
ggtggtgttgtggatggggcgattggggcggaggaggaagcagagcgccagcagcagcag
cagcagcagcagcagcagcagcagcagcaacagcagcaggaggaggccgaggagttcgat
tatctcgcgtatgcgcaggacagggcgtatttcttcctgggcgactgcgtcgcgatgggg
ctggtcacgaccgaggagctgggcgaggaggtcagccggaggattaaggtggtggagtac
taa

DBGET integrated database retrieval system