KEGG   Thielavia terrestris: THITE_2112311Help
Entry
THITE_2112311     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
ttt  Thielavia terrestris
Pathway
Cell cycle - yeast
Class
Cellular Processes; Cell growth and death; Cell cycle - yeast [PATH:ttt04111]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(join(2041775..2042662,2042721..2044346))
Genome map
AA seq 837 aa AA seqDB search
MARDENAALFSDDESTKDLEALKPMKLSALTKALLGDNVSNGSTTPPRRSSIPGPVRPTP
GDHESSWRRTRDGQIRRTPSPSGWEPRKQENSSPTPVNKTPSPSPSRPQSPVPRKRVVRL
GTGHSANSAQRSNPSTAHHHSQRASLSISTRGKRPQSSDGSKVTKESPAVSQEQPAKTPV
VPLRTVRIAVSSSGRKPTDGSSDVRPKYNTRSAAREAQSGPVSSTRSSAAASQSSMRVKR
VAKNPGSFLSGPARRGLRRQSEEEPEAQPEVDADGSSQEPRSQHPQSGSHQDPPQSAASR
YDDSAASGSPISARVSALAALRKQKSTFMSPYGQQKSEDEHLKLLYRMPAPLPQDVAKED
KENNISSKIPAAAPTSIATKNRPPSAADEKVPAQIAPPATSASIKAAPKDNDNVLAAKPH
NAPQRSAAPPPPPKMSVVETATTAAGASTAASKKKQFLFRVNGRMYTRLDTLGRGASSKV
YRVSAENGKILALKRVSLEGLDDRTIKGYKGEIDLLKRLSGVNRVIQLIDHEFNEEKQML
SIVLEVGELDFLTFLRSRTSEDSKFDPVFVRYWWKEMVECVQAVHAKDIIHTDLKPQNFV
IAQGRLKVIDFGIANAIQTDMTVNVHRDAQVGTPNYMSPESLMDFKEYALNSANQGSSGV
PLLHRPKHFKLGKSCDVWSLGCILYQLVYGMGPFGHISNVVHRIHAIINFNHQINFPETT
QDGVRVPPSLIRTMRRCLQRDQSLRPSCDELLSETDPFLYPLELSPSVFAAADHGDVLPI
TSDLLRDVIWNVVRRCRQGNVDENEALRLWPAAYWASCKKVLAGMNASGGGGNGRQA
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atggcgagagacgaaaacgcagccttgttctcggacgacgagagcactaaagatcttgag
gcgctgaagcctatgaagctcagcgcgctcaccaaagcgcttcttggagacaatgtctcg
aatggatcaacgacgccgccgcggcggagttcaattccaggcccggtgcggccgacacca
ggagaccacgagtcttcttggcgacgcacccgtgacggacagattcgtcggacaccctct
ccgtctggctgggagccgcggaagcaggaaaactcttctcccacccctgttaataaaacg
ccatcgccatctccaagtcgaccccaaagcccagtgccccggaagagagtcgtgcgcctc
ggcaccggccattccgcgaactcagcccagaggtcaaatccgagcacggcccaccatcac
agtcagcgggcctccctctcgatatccactcgaggaaaaagaccgcagagctcggacggc
tccaaggtgaccaaagagtcaccagctgtatcccaagaacagcctgctaagaccccagtg
gttccgttgagaaccgttcggattgccgtttcatcatccggccgcaaacccacagacggt
tcatcggatgtccgccccaaatacaacacacgctcggccgcccgtgaagctcagtctgga
cccgtttcctcgacacggtcatccgccgcagcctcgcaaagctcaatgcgggtcaagaga
gttgcgaagaatccaggcagcttcctttctggccccgctcgtcgcggacttcggagacag
agcgaggaagagcctgaggcccagccagaggtagacgcggatggctcgagtcaggagcct
agaagccagcatcctcagtccggaagccaccaagaccctcctcaatcagcagcttcaaga
tacgatgactcagccgcgtctggcagccctattagcgccagggtctcagctttggctgct
ctccggaaacagaagtcgactttcatgtcaccctacgggcagcagaagtctgaggatgag
catctaaagctcctctaccggatgcccgctccgcttccgcaggacgtcgccaaggaagac
aaggagaataacatttcatccaaaatccccgctgcggcgccgacttcaattgcgacaaag
aaccgccctccttccgctgccgacgagaaggtgccggcgcagatcgcaccacctgccacg
tcagccagcatcaaagccgcccccaaggacaacgacaacgtcctggccgccaaacctcac
aatgcgcctcaaagaagtgcagcgcctcctcctccccctaagatgtcggtggtcgagacg
gccaccactgctgccggtgcttcgaccgccgccagcaagaaaaaacagttcttgtttcgc
gtcaacggcagaatgtatacacgcctcgatacgctcggccgcggcgcatccagcaaagtc
taccgcgtttcagccgaaaacgggaagattcttgcgctcaagcgcgtctcgcttgaaggc
ctggacgacagaaccatcaaaggttacaaaggagagatcgacttgctgaaacggctatcc
ggggtcaatcgtgtcattcaacttatcgaccacgaattcaacgaggagaaacagatgctt
agcattgtgttggaagtcggggagctcgacttcttgactttcctccgaagccggacctca
gaagacagcaaattcgacccggtttttgttcggtattggtggaaagagatggtcgagtgt
gtccaggcagtgcacgccaaggatatcatccacaccgatctcaagccccagaacttcgtc
attgcccaaggccgactgaaagttatcgattttggcatcgccaacgccatccaaaccgac
atgacggtcaatgtgcaccgcgacgcgcaggtcggcactccgaattacatgtcgcccgag
tccctgatggatttcaaggaatacgccctcaactcggccaaccagggctcttctggtgtc
ccgctcttgcatcgacccaaacacttcaagctcggcaagtcgtgcgacgtctggagcctg
ggttgcatcctgtaccagctcgtgtacggaatggggccgttcggccacatctccaacgtc
gttcatcgcattcatgccatcataaacttcaatcaccaaatcaacttcccagaaaccacc
caggacggtgtccgggtgccccccagcctcattcgaactatgcgacgatgtctgcagcgc
gatcagtcgctgaggcccagctgcgacgagctgctctccgaaacggaccccttcttgtat
cctctggagctgtcgcccagcgtctttgcggcggcagaccatggcgacgtccttccgatt
acgtcggacctccttcgggatgtcatctggaatgtcgttcggcgctgccggcaaggcaat
gttgacgagaacgaagccctcagactctggccagccgcttactgggcgagctgcaagaaa
gttctggctggcatgaatgcttctggtggaggcggaaacgggcggcaagcctga

DBGET integrated database retrieval system