KEGG   Thielavia terrestris: THITE_2112611Help
Entry
THITE_2112611     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ttt  Thielavia terrestris
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ttt00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    THITE_2112611
Enzymes [BR:ttt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     THITE_2112611
Peptidases [BR:ttt01002]
 Cysteine Peptidases
  Family C44
   THITE_2112611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(join(2499365..2500542,2500613..2500841))
Genome map
AA seq 468 aa AA seqDB search
MVLGVREQLTEAIRLRLRADVPVGIYLSGGIDSSLVAGIVTHLVREEGARLGNQDATSRI
CCFSIEFPGQGSYDESDVAERTANWLGVQILKKRMDEATLADNFADSVWHCEHHNMNLNS
VGKFVLSTLPREHGFKVVLTGEGSDEHFAGYPWLIGEFLREPDPAMPGTELARDAALRDS
LRERGRREFMAMVQRERSLGSRNPTNPEAFRAVNEVRMLGLTQAFLPPPALWSSWVREAW
AGADPVMAQTAEMPEEAKQKMRETWHPLHTAQYLWSRSLLANMLLTCLGDRTEMAHSIEA
RPPFLDHVLSEYANGLPPSVKLAYTPERENEARSGGLPWENGNVLADLFTEKWILREAGK
PFITQELYERKKQPYVAPNRWPKDGPLDKKMREICTREAVERLGFVDYEHVKAAMDTAFG
DDADRGSFRLLLAVAAWVTISERFGVRRAEPSDQARGGNTDGGLGGQA
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgggcgtgcgcgagcagctgaccgaggcgatccgcctgcggctgcgcgccgac
gtgcccgtcggcatctacctgtcgggcggcatcgactcgtccctggtggccggcatcgtg
acgcacctcgttcgcgaggagggcgcgcggctcggcaaccaggacgcgaccagccgcatc
tgctgcttcagcatcgagttccccggccagggcagctacgacgagtcggacgtcgccgag
cggacggccaactggctgggcgtgcagatcctcaagaagcgcatggacgaggccacgctg
gccgacaacttcgccgactcggtctggcactgcgagcaccacaacatgaacctgaactcg
gtcggcaagttcgtcttgtccaccctccctcgcgagcacggcttcaaggtcgtgctcacg
ggcgagggctccgacgagcacttcgccggctacccctggctcatcggcgagttcctgcgc
gagcccgacccggccatgcccgggaccgagctggcccgggacgcggcgctgcgcgacagc
ctgcgggagcgcggccgcagggagttcatggcgatggtgcagcgggagcggagcctgggt
tcgaggaaccccaccaacccggaggcgttccgcgccgtcaacgaggtcaggatgctgggg
ctgacgcaggcgttcctgccgccgcccgccctctggagctcgtgggtgcgcgaggcgtgg
gccggcgcggaccctgtgatggcgcagaccgcggagatgccggaggaggcgaagcagaag
atgcgcgagacgtggcacccgctgcacacggcgcagtacctgtggagccggtccctgctc
gccaacatgctgctgacgtgtttgggcgatcgcaccgagatggcccacagcatcgaggcg
cgcccgccgttcctcgaccacgtgctgtccgagtacgcgaacgggctgccgcccagcgtc
aagctggcctacacccccgagcgggagaacgaggcccgcagcggcgggctgccgtgggag
aacgggaacgtcctcgcggacctgttcacggagaagtggatcctgcgggaggcgggcaag
ccgttcatcacccaggagctgtacgagcgcaagaagcagccgtacgtggcgcccaaccgg
tggcccaaggacgggccgctggacaagaagatgagggagatctgcaccagggaggcggtc
gagaggctcgggtttgtcgattacgagcacgtgaaggcggccatggacacggcgttcggc
gacgacgcggaccgcgggtcgttcaggctgctgctcgccgtggcggcgtgggtaacgatc
agtgagcgcttcggcgtgcggcgggccgagccgagcgaccaagcgaggggaggaaacacc
gatggaggtctgggcgggcaggcatga

DBGET integrated database retrieval system