KEGG   Thielavia terrestris: THITE_2112611Help
Entry
THITE_2112611     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ttt  Thielavia terrestris
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ttt00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(join(2499365..2500542,2500613..2500841))
Genome map
AA seq 468 aa AA seqDB search
MVLGVREQLTEAIRLRLRADVPVGIYLSGGIDSSLVAGIVTHLVREEGARLGNQDATSRI
CCFSIEFPGQGSYDESDVAERTANWLGVQILKKRMDEATLADNFADSVWHCEHHNMNLNS
VGKFVLSTLPREHGFKVVLTGEGSDEHFAGYPWLIGEFLREPDPAMPGTELARDAALRDS
LRERGRREFMAMVQRERSLGSRNPTNPEAFRAVNEVRMLGLTQAFLPPPALWSSWVREAW
AGADPVMAQTAEMPEEAKQKMRETWHPLHTAQYLWSRSLLANMLLTCLGDRTEMAHSIEA
RPPFLDHVLSEYANGLPPSVKLAYTPERENEARSGGLPWENGNVLADLFTEKWILREAGK
PFITQELYERKKQPYVAPNRWPKDGPLDKKMREICTREAVERLGFVDYEHVKAAMDTAFG
DDADRGSFRLLLAVAAWVTISERFGVRRAEPSDQARGGNTDGGLGGQA
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgggcgtgcgcgagcagctgaccgaggcgatccgcctgcggctgcgcgccgac
gtgcccgtcggcatctacctgtcgggcggcatcgactcgtccctggtggccggcatcgtg
acgcacctcgttcgcgaggagggcgcgcggctcggcaaccaggacgcgaccagccgcatc
tgctgcttcagcatcgagttccccggccagggcagctacgacgagtcggacgtcgccgag
cggacggccaactggctgggcgtgcagatcctcaagaagcgcatggacgaggccacgctg
gccgacaacttcgccgactcggtctggcactgcgagcaccacaacatgaacctgaactcg
gtcggcaagttcgtcttgtccaccctccctcgcgagcacggcttcaaggtcgtgctcacg
ggcgagggctccgacgagcacttcgccggctacccctggctcatcggcgagttcctgcgc
gagcccgacccggccatgcccgggaccgagctggcccgggacgcggcgctgcgcgacagc
ctgcgggagcgcggccgcagggagttcatggcgatggtgcagcgggagcggagcctgggt
tcgaggaaccccaccaacccggaggcgttccgcgccgtcaacgaggtcaggatgctgggg
ctgacgcaggcgttcctgccgccgcccgccctctggagctcgtgggtgcgcgaggcgtgg
gccggcgcggaccctgtgatggcgcagaccgcggagatgccggaggaggcgaagcagaag
atgcgcgagacgtggcacccgctgcacacggcgcagtacctgtggagccggtccctgctc
gccaacatgctgctgacgtgtttgggcgatcgcaccgagatggcccacagcatcgaggcg
cgcccgccgttcctcgaccacgtgctgtccgagtacgcgaacgggctgccgcccagcgtc
aagctggcctacacccccgagcgggagaacgaggcccgcagcggcgggctgccgtgggag
aacgggaacgtcctcgcggacctgttcacggagaagtggatcctgcgggaggcgggcaag
ccgttcatcacccaggagctgtacgagcgcaagaagcagccgtacgtggcgcccaaccgg
tggcccaaggacgggccgctggacaagaagatgagggagatctgcaccagggaggcggtc
gagaggctcgggtttgtcgattacgagcacgtgaaggcggccatggacacggcgttcggc
gacgacgcggaccgcgggtcgttcaggctgctgctcgccgtggcggcgtgggtaacgatc
agtgagcgcttcggcgtgcggcgggccgagccgagcgaccaagcgaggggaggaaacacc
gatggaggtctgggcgggcaggcatga

DBGET integrated database retrieval system