KEGG   Thielavia terrestris: THITE_2112905Help
Entry
THITE_2112905     CDS       T02228                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
ttt  Thielavia terrestris
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(join(3033198..3035890,3035970..3036909,3037054..3037611))
Genome map
AA seq 1396 aa AA seqDB search
MSAVSLDVPRPGQFGRAKSAAQVPRTAALAMSAASSPARHPGSFSRQTTQAVSQLQAQYA
EASASASAAHQNGPMRSASPAFAPPKPGPPLPNGRQRAASPGPSSRRPSSAPGDREVISD
SGHTDESDHVAVARPAKPPLLRSKSEHAVRHDATGSDPDEEYYDLGARHGFEDHYLSEDI
IAQLANNWYMYFTDKRHETTGKPKTPAFELQDWRMRDRLKTVSAAIAVCLNIGVEPPDQL
RTTPGAKLEAWQDPTVPPVGKALENIGKSLQTQYETLAFRTRYKQYLDPSIEETKKFCIS
LRRNAKDERVLFHYNGHGVPKPTASGEIWVFNKNYTQYIPVSLYDLQHWLQAPTIFVWDC
SEAGNILKNYHKFVEKHEQEEEEQTVRDPNHEKLNYRPYIHLAACDSKENLPTNPLLPAD
LFTCCLTTPIEMALWFFVLQNPLKTDITPERARKLPGKLQERRTPLGELNWIFTAITDTI
AWTTLPRPLFRKFFRQDLMVAALFRNFLLAQRIMPVYGCRPQSYPELPDTRRHPLWESWD
LAVDMALAQLPMLERKETEGIPYEYVNSTFFTEQLTAFEIYLTRGDAVSQKPPEQLPVVL
QVLLSQQHRLRALILLGRFLDLGPWAVQLALSIGIFPYVLKLLQSAAQELKPVMVFIWTR
ILAVDISCQQDLIKDNGYTYFAAIMKPQETFPVVGVVVLDEHKAMCAFILAMLCKGFKPG
QIVCNSTDIMTYCLHHIEHPENPLLRQWSCLCISQLWQNLADAKWRGIRENAHHKLSYLI
KDPCPEVRAAMAHAMTTFLGIPDLTDEVARIEEGIAWAMLELATDGSPIVRKELLVFFSH
FVLRYESKFLVAAYEQLLEEREYQLFPPPEDGLDHKMGLHYARRENRERDGTIKPTAFGV
AHDSVFAACLKHINILSVDPHPEVQRDATIILDYIHHALLHSPLGPRAQNLMDEILRRAR
KVSRGDMSQRTSVAGTRTAVAQPMPSPGLLKRTASYLFGPLALMGVLDGSSSAPTPPATP
GLHRTFSQRSRRGPGLEDAPPEQHDQAAPPSNYHIANEPLCAGYKERQLKEVPTLPLVST
FLDWSTEYFREPQMKAPEAEEPGSNEYNERLWRRGRNEAILRETQPQKTHARTHKWNSQA
GVIITGSQPSKMTFHQFENHVAVADDGNTVTVWDWKNNTRKSRFSNGNPEGSKISDMRFI
NEDDQALLMTGSSDGVIRVYHNYDSDTDVELASSWRALTHMVPSNVNSGMVFDWQQVNGQ
VLVAGDERVIRIWNAGHEMCTHEIPARSGSCVTSLTSDQMTGNIFVAGFGDGAIRVFDTR
LRPQESMVRKWKDESRQWVRSVHMQRGGQRELLSASRNGKVHLWDIRMDQPLKTFQTTKD
VLRTASTHEHLPVFAM
NT seq 4191 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcagtttccctcgacgtgccgcgacccggtcagttcggccgagccaagagcgca
gcccaggtcccgcggaccgccgctcttgcaatgtcggctgcgtcgtctcctgcacgccat
cccggctccttctcgcgccagacgacccaggcggtatcgcaactacaggcccagtacgcc
gaggcatcggcgtctgcatcggcggcgcatcaaaacggtcccatgcgctccgcgtctccc
gccttcgctcccccgaagcccgggccgccgcttcccaacgggaggcaaagggccgcatcg
cctggtccttcctcgcgacgaccctcgagcgcgccgggagacagagaggttatttccgac
agcggacataccgacgagagcgaccacgtcgccgtcgcgcgacccgctaaaccgccactg
ctccgctccaagagcgagcacgccgtgcgccacgatgcgaccggttccgatcccgatgag
gaatactacgacttgggtgctcggcatggctttgaggatcattatctgtccgaggacatc
atcgcccagcttgcgaacaactggtacatgtatttcaccgacaagcggcacgaaacaaca
ggcaagccgaagacgcctgcgtttgaacttcaggactggcgaatgcgtgatcgacttaag
acggtctcagcagccatcgccgtatgcctgaacatcggtgttgagccccctgaccaattg
cgcacaacgcccggcgcaaagctcgaggcctggcaagaccccactgtccccccggtgggc
aaggcgctcgagaatatcggcaagtcgcttcagacgcagtatgagactttggccttccga
acccgctacaagcagtacctggacccgtccatcgaggaaaccaagaaattctgcatatct
ctgcgccggaatgcgaaggacgagcgggtgctcttccattacaatggccacggagtcccg
aagccgactgcttccggcgagatctgggttttcaacaaaaactacacccagtacattccc
gtgtcgctatacgatcttcagcactggctgcaggcgcccaccatctttgtgtgggactgc
tccgaggcgggcaatatcctcaagaactaccacaagtttgtcgagaagcatgagcaggag
gaagaagagcagaccgtcagggatcccaaccacgagaagctgaactaccgcccttacatc
catctcgcggcttgcgactccaaggagaacctcccgacgaatcctcttctcccggcggat
ctctttacctgttgcttgaccacaccgatcgagatggccctgtggttcttcgttctgcag
aatccgctgaagaccgacatcacgcccgagagagcgaggaagcttcccgggaagctccag
gaacgacggacgcccctgggagagctaaattggattttcacggccattaccgacaccatc
gcctggacgactctgccccgacctttattccggaagttcttccgtcaggacctgatggtg
gccgccctgttccgcaacttcctccttgctcagcgtatcatgcccgtctacggctgcaga
ccccagtcctaccctgagctgccagatacccgccggcacccgctctgggagagctgggac
ctcgccgttgacatggcattagcgcagctccccatgctggagaggaaggaaaccgagggc
atcccgtacgaatacgtcaactcgaccttcttcaccgaacagctcacggctttcgagatc
tacttgactagaggcgacgcagtctcgcaaaagccccctgagcagctccccgtggtcctc
caagtcctcctcagccagcaacatcggctccgggccttgatccttttgggcagattcctt
gacctcgggccatgggcggtgcagctagcattgagtataggcatcttcccttatgtgctg
aagctgctgcaatcggctgcacaagagctcaagccggtcatggttttcatctggacccgt
atcctcgccgttgacatctcctgccaacaggacctgatcaaggacaacggctacacctat
ttcgctgccatcatgaagccgcaagagaccttccccgtcgtcggcgtcgtggttctggac
gagcacaaggccatgtgcgccttcatcctcgcgatgctgtgcaagggcttcaagcctggt
cagatcgtctgcaactcgaccgacatcatgacctactgcctgcatcatattgagcatccc
gagaaccccctgctccggcaatggtcgtgcctctgcatcagccagctctggcagaatctc
gcggatgcgaagtggcgaggcatccgggagaacgcgcatcacaagctctcctacctgatc
aaggacccgtgccccgaagttcgcgccgccatggcgcacgccatgaccaccttcctcggc
attcccgatctcaccgatgaggtggccagaatcgaagagggcatcgcctgggccatgctt
gagctcgccacagacgggagcccgatcgtccggaaggagctcctcgtctttttctcgcat
ttcgtgctccgctacgagagcaagttcttggtcgcagcctacgagcagctcttggaggag
agggagtaccaactcttccccccgccagaggatggcctggaccacaagatgggattgcac
tatgcgaggcgcgagaaccgcgagagagatggcaccatcaagcctactgcgttcggtgtg
gcgcacgactccgtgtttgcagcatgcctgaagcacatcaacatcttgagcgtggatccg
catcctgaggtgcagagggacgccaccatcatcctggactatatccaccacgcactgctg
cactctcctcttggtccacgggcgcagaatctcatggacgagatcctccgacgcgctaga
aaagtgtcgaggggtgacatgagccaaaggaccagcgtggctggtacgcgcactgcagtg
gctcagccgatgccatcgccaggcctcctgaagcggaccgcaagttatctcttcgggccg
ctggcgctgatgggcgtgctggacggttcctccagtgcgcccacccctccggctactccc
gggttgcaccggacattctctcaacggagtcgcagaggccccggtcttgaggacgctccc
ccggagcagcacgaccaggccgcacctccgtcgaactaccatatcgcaaatgagccgctg
tgcgccggctacaaagaacgccagctgaaggaagtgcccacccttcccttggtgagcacc
ttcttggactggtcgaccgagtacttccgggagcctcagatgaaggcgcccgaagccgaa
gagcccggcagcaacgaatataatgaacggctgtggcggcggggccggaacgaagccatc
ctcagagagacgcagccgcagaaaacccatgctaggacgcacaagtggaacagccaggcc
ggcgtgatcatcactggctcccagccgtcaaagatgactttccaccaattcgaaaaccac
gtcgctgtggcggacgacggtaacaccgtgacagtctgggattggaagaacaacacccgg
aagagccgcttctccaacggcaacccggaggggtccaagatctccgacatgaggttcatc
aacgaggatgaccaggccctcctcatgacgggttcctcagacggcgtgattcgcgtctat
cacaactacgacagcgacacggacgtggaactcgcgtcctcgtggcgcgcgctcacccac
atggtcccctccaacgtcaactccggcatggtcttcgactggcaacaggtcaacggtcag
gtgctggtggccggcgacgagcgagtcatacggatctggaacgcgggccacgagatgtgc
acccacgagatccccgcgcggtcgggctcctgcgtgacgtcgctgacgtcggaccagatg
acgggcaacatctttgtcgccgggttcggcgacggcgccatccgcgtcttcgacactcgc
ctgcggccacaggagagcatggtccgcaagtggaaggacgagagcagacagtgggtgcgc
tcggtgcacatgcagcgcggcggccagcgcgagctcctctccgctagccgcaacggcaag
gtccacctctgggacatccgcatggaccagcccctgaagacgttccagacgaccaaggac
gtgctgcgcactgcaagcacccacgagcatctccccgtgtttgcaatgtaa

DBGET integrated database retrieval system